Recombinant Human Ceramide synthase 4 (CERS4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human CERS4

Recombinant Human CERS4 is a laboratory-produced version of the ceramide synthase 4 enzyme, generated using HEK293T cells transfected with the CERS4 cDNA clone . It is tagged with C-Myc/DDK for detection and purification purposes, with a molecular weight of 46.2 kDa . CERS4 catalyzes the synthesis of ceramides containing C18–22 fatty acids, influencing cellular processes such as proliferation, differentiation, and apoptosis .

Role in Liver Cancer Proliferation

  • Overexpression in HCC: CERS4 mRNA and protein levels are significantly elevated in hepatocellular carcinoma (HCC) tissues compared to normal liver tissue .

  • Knockdown Effects: Silencing CERS4 via lentivirus-mediated RNA interference (RNAi) reduced HepG2 and Huh7 liver cancer cell proliferation by 70% (P < 0.001) and inhibited colony formation .

  • Mechanistic Insights: CERS4 regulates the NF-κB signaling pathway, modulating nuclear translocation of NF-κB and downstream targets like IKBKG and TANK .

Association with Colorectal Cancer (CRC)

  • KRAS Mutation Link: CERS4 expression is significantly reduced in CRC tumors with KRAS mutations (P = 0.004), correlating with increased venous invasion .

  • Therapeutic Implications: Low CERS4 levels may serve as a biomarker for aggressive CRC subtypes .

Regulation of Stem Cell Differentiation

  • Hair Follicle Stem Cells (HFSCs): In murine models, CerS4 deficiency shifts HFSC differentiation toward sebaceous gland lineages and disrupts lineage-specific markers like Lhx2 and keratin-6 .

  • Proteomic Changes: CerS4 knockout organoids show upregulated urothelial hair follicle (uHF) and sebaceous gland markers, indicating altered cell fate determination .

Broader Biological Roles

  • Neurological Disease: Elevated CERS4 expression is observed in Alzheimer’s disease mouse models .

  • Metabolic Regulation: CERS4 interacts with leptin signaling to modulate ceramide levels in adipose tissue, influencing body weight and food intake .

Clinical and Therapeutic Implications

  • Anticancer Target: CERS4 suppression inhibits tumor growth in vivo, suggesting potential as a therapeutic target for HCC .

  • Diagnostic Biomarker: Elevated CERS4 in HCC and reduced levels in KRAS-mutant CRC highlight its context-dependent diagnostic utility .

  • Limitations: Conflicting roles in different cancers (pro-tumorigenic in HCC vs. tumor-suppressive in CRC) necessitate further mechanistic studies .

Technical Applications of Recombinant CERS4

Recombinant CERS4 is utilized to:

  • Investigate enzyme kinetics and substrate specificity .

  • Develop assays for ceramide synthase activity in cancer and metabolic studies .

  • Validate interactions with signaling pathways (e.g., NF-κB) using overexpression or knockdown models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
CERS4; LASS4; Ceramide synthase 4; CerS4; LAG1 longevity assurance homolog 4; Sphingosine N-acyltransferase CERS4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CERS4
Target Protein Sequence
MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFI GLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRR RRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLY WWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHD SSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFF GYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPL QLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT
Uniprot No.

Target Background

Function
Ceramide synthase 4 (CERS4) catalyzes the formation of ceramide from sphinganine and acyl-CoA substrates. It exhibits high selectivity towards long and very-long chain (C18:0-C22:0) acyl donors.
Gene References Into Functions
  1. Nine single nucleotide polymorphisms (SNPs) within the CERS4 region were associated with circulating C23:0 levels (adjusted P<5x10-2) PMID: 29738550
  2. These findings suggest that phosphorylation of ceramide synthases may be a key regulatory mechanism controlling the distribution and levels of sphingolipids with various acyl-chain lengths. PMID: 26887952
  3. CerS4 mRNA levels are elevated in cancerous cell lines and decrease following the induction of apoptosis. PMID: 25779024
  4. Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. However, no impact on cell proliferation was detected. PMID: 23538298
  5. The linkage and association of phospholipid transfer protein activity to LASS4 were investigated. PMID: 21757428

Show More

Hide All

Database Links

HGNC: 23747

OMIM: 615334

KEGG: hsa:79603

STRING: 9606.ENSP00000251363

UniGene: Hs.515111

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of CERS4 in cellular metabolism?

CERS4 is one of six mammalian ceramide synthases that catalyzes the formation of an amide bond between a sphingoid base and a fatty acyl-coenzyme A, playing a critical role in sphingolipid metabolism . This enzyme specifically regulates the production of ceramides, which serve as both structural components in cell membranes and bioactive signaling molecules involved in various cellular processes including apoptosis, proliferation, and differentiation .

How does CERS4 differ from other ceramide synthase family members?

CERS4 exhibits distinct substrate specificity compared to other CERS family members. While detailed substrate preference data wasn't provided in the search results, research shows that CERS4 has different kinetic properties, with a measured Km value of approximately 3.4 ± 1.5 μM toward NBD-Sph (a fluorescent sphingosine analog used in laboratory assays) . CERS4 also demonstrates tissue-specific expression patterns and unique roles in pathological conditions, particularly in certain cancer types like colorectal and liver cancers .

How is CERS4 expression altered in colorectal cancer with KRAS mutations?

CERS4 expression is significantly downregulated in colorectal cancer (CRC) with KRAS mutations compared to KRAS wild-type tumors (p = 0.004) . The median expression level of CERS4 in KRAS wild-type CRC was 2.71 (range: 0.23–17.50), while in KRAS mutant CRC, it was only 1.07 (range: 0.07–4.99) . This finding suggests that KRAS mutations may influence sphingolipid metabolism through downregulation of CERS4, potentially contributing to the more aggressive nature of KRAS-mutated colorectal cancers.

What is the relationship between CERS4 expression and vascular invasion in cancer?

Interestingly, there is a significant association between CERS4 expression and vascular invasion in colorectal cancer, although the relationship appears complex. When using a cut-off value of 0.8 for CERS4 expression, venous invasion was significantly more prevalent in the low-CERS4 group (p = 0.0057) . This suggests that decreased CERS4 expression may contribute to enhanced vascular invasion capabilities of cancer cells, potentially through altered sphingolipid metabolism affecting downstream mediators like sphingosine 1-phosphate (S1P), which plays important roles in vascular system regulation .

What is known about CERS4 expression in liver cancer?

CERS4 has been found to be highly expressed in liver cancer tissues compared to normal liver tissue . This overexpression pattern differs from what's observed in colorectal cancer with KRAS mutations (where CERS4 is downregulated), suggesting that CERS4 may play cancer-type specific roles . The high expression of CERS4 in liver cancer suggests it may function as an oncogenic factor in this particular cancer type.

Cancer TypeCERS4 Expression PatternAssociated Molecular FeaturesReference
Colorectal CancerDecreased in KRAS-mutant tumorsAssociated with venous invasion when expression is low
Liver CancerIncreased compared to normal tissueAffects NF-κB signaling pathway

What are the optimal methods for measuring CERS4 enzymatic activity?

A rapid and efficient method for measuring CERS4 enzymatic activity utilizes NBD-sphingosine (NBD-Sph) as a fluorescent substrate. This assay can be performed in small reaction volumes (20 μl) with as little as 10-20 μg of protein and a reaction time of 20 minutes for CERS4 . The assay involves measuring the conversion of NBD-Sph to NBD-ceramide, which can be separated by either thin-layer chromatography (TLC) or solid-phase extraction (SPE) columns. SPE columns offer advantages of higher throughput and avoiding potential degradation of sphingosine on TLC plates . The assay is conducted at 37°C with NBD-Sph, the appropriate acyl-CoA substrate, and defatted BSA in a suitable buffer system .

How can CERS4 be effectively silenced in experimental models?

Lentivirus-mediated RNA interference (RNAi) technology has been successfully employed to knockdown CERS4 expression in cancer cell lines. In experimental settings, CERS4 short hairpin RNA (shRNA) targets can be cloned into lentiviral vectors, and the packaged lentivirus can be used to infect target cells . This approach has demonstrated high infection efficiency (>90%) and effective reduction of CERS4 mRNA expression levels (approximately 70% reduction) in liver cancer cell lines like HepG2 . This method allows for stable, long-term silencing of CERS4 for both in vitro and in vivo studies examining its functional roles.

What are the key considerations when designing experiments to study CERS4 substrate specificity?

When studying CERS4 substrate specificity, researchers should consider several factors. First, appropriate acyl-CoA substrates must be selected based on the known or hypothesized chain-length preferences of CERS4. Second, assay conditions need optimization for CERS4 specifically, as different ceramide synthases display varying specific activities . Based on the search results, using 10-20 μg of protein and 20 minutes reaction time has been effective for CERS4 activity assessment . Additionally, researchers should consider using multiple analytical methods (e.g., mass spectrometry, fluorescent substrates) to comprehensively characterize substrate specificity. Kinetic parameters, such as Km values, should be determined for different substrates to quantitatively assess preference (the Km of CERS4 toward NBD-Sph was reported as 3.4 ± 1.5 μM) .

How does CERS4 interact with the NF-κB signaling pathway in cancer cells?

Experimental evidence indicates that CERS4 affects the NF-κB signaling pathway in liver cancer cells. When CERS4 was silenced in liver cancer cells, significant changes were observed in the expression levels of key genes involved in the NF-κB pathway, specifically Ikbkg and Tank, whose mRNA levels decreased dramatically . In contrast, knockdown of CERS4 did not significantly affect p53 or components of the Wnt signaling pathway (Gsk-3β and β-catenin1) . It has been suggested that in KRAS mutant colorectal cancer, CERS4 expression may be reduced due to the influence of the NF-κB pathway . These findings suggest a bidirectional relationship between CERS4 and NF-κB signaling, which may be important for the regulation of cancer cell proliferation and survival.

What are the consequences of altered ceramide species profiles resulting from CERS4 dysregulation?

Altered CERS4 expression affects the balance of ceramide species within cells, which has significant functional consequences. Research has shown that overexpression of CERS4 and CERS6 in colon cancer cells induces the production of specific short-chain ceramides (C16:0, C18:0, and C20:0 ceramides), which weakens cell proliferation and promotes apoptosis . In the context of reduced CERS4 expression, as observed in KRAS mutant colorectal cancers, this may result in diminished proapoptotic ceramide species, potentially contributing to cancer progression . Additionally, ceramides are precursors for other bioactive sphingolipids such as sphingosine 1-phosphate (S1P), which plays important roles in vascular and immune system regulation . Therefore, CERS4 dysregulation can have cascading effects on multiple sphingolipid-dependent cellular processes.

How does CERS4 function differ in various cellular compartments?

The search results do not specifically address how CERS4 function differs across cellular compartments. This represents a gap in our understanding that would require further investigation. Ceramide synthesis occurs primarily in the endoplasmic reticulum, but ceramides and related sphingolipids are trafficked to various cellular compartments where they may serve different functions. Understanding the compartment-specific activities of CERS4 would provide insights into its diverse roles in cellular physiology and pathology.

How can CERS4 expression be utilized as a biomarker in colorectal cancer?

CERS4 expression shows potential as a biomarker in colorectal cancer, particularly in relation to KRAS mutation status and vascular invasion. ROC analyses identified an optimal cut-off value of 0.800 for CERS4 expression in colorectal cancer tissue, with an AUC of 0.694 (sensitivity: 0.83, specificity: 0.35) . Low CERS4 expression (below 0.8) was significantly associated with KRAS mutations (p = 0.0015) and increased venous invasion (p = 0.0057) . These associations suggest that CERS4 expression levels could help identify specific CRC subtypes with distinct molecular characteristics and invasive potential, potentially guiding treatment decisions or prognostic assessments.

What are the critical gaps in our understanding of CERS4 biology?

Several critical knowledge gaps exist in CERS4 biology. First, the detailed mechanisms through which KRAS mutations lead to CERS4 downregulation in colorectal cancer remain incompletely understood . Second, the seemingly contradictory roles of CERS4 in different cancer types (potentially tumor-suppressive in colorectal cancer versus tumor-promoting in liver cancer) need further investigation . Third, the specific ceramide species produced by CERS4 in different physiological and pathological contexts, and their downstream effects, require more comprehensive characterization. Finally, the potential cross-talk between CERS4 and other major signaling pathways beyond NF-κB warrants exploration.

How might single-cell approaches advance our understanding of CERS4 in heterogeneous tumor environments?

Single-cell approaches could significantly advance CERS4 research by revealing cell type-specific expression patterns and functions within heterogeneous tumor microenvironments. These techniques could identify subpopulations of cancer cells with varying CERS4 expression levels and correlate these with other molecular features, such as KRAS mutation status, proliferative capacity, or invasive potential. Single-cell lipidomics could potentially map ceramide species distributions at the individual cell level, providing unprecedented insights into how CERS4 activity shapes the sphingolipid landscape across different cells within a tumor. Furthermore, single-cell approaches could elucidate how CERS4 expression in non-cancer cells within the tumor microenvironment (e.g., endothelial cells, immune cells) might influence cancer progression through altered sphingolipid signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.