Recombinant Human Ceramide synthase 5 (CERS5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Ceramide Synthase 5 (CERS5)

Recombinant Human Ceramide Synthase 5 (CERS5), also known as LASS5, is a recombinant protein derived from human CERS5 gene expression. This enzyme belongs to the ceramide synthase (CerS) family, which catalyzes the synthesis of ceramides by attaching acyl-CoA chains to sphingosine or dihydrosphingosine. CERS5 specifically exhibits substrate specificity for long-chain acyl-CoAs (C14:0–C18:0), with a particular preference for C16:0-CoA, producing C16:0-ceramides .

Key Features of CERS5

  • Gene Name: CERS5 (also LASS5)

  • Protein Family: TLC domain-containing proteins (TRAM, LAG1, CLN8 homologs)

  • Enzymatic Activity: Sphingosine N-acyltransferase (EC 2.3.1.24)

  • Localization: Endoplasmic reticulum membrane, integral to lipid bilayers .

Biochemical Characteristics and Functional Mechanisms

CERS5 operates as a membrane-bound enzyme, dimerizing with other CerS isoforms (e.g., CerS2) to modulate ceramide synthesis . Its structural features include:

  • Substrate Specificity: Primarily C14:0–C18:0-CoAs, with optimal activity for C16:0-CoA .

  • Tissue Expression: Widely expressed in low levels across tissues, including lung, spleen, muscle, liver, and adipose tissue .

  • Regulatory Role: Maintains systemic ceramide pools critical for energy homeostasis and immune function .

Table 1: Substrate Specificity and Tissue Expression of CERS5

FeatureDetails
Substrate PreferenceC14:0–C18:0-CoAs, particularly C16:0-CoA
Tissue DistributionLung, spleen, muscle, liver, adipose tissue, and epithelial barriers
Structural PartnersDimerizes with CerS2 to enhance enzymatic activity

Recombinant Protein Production and Research Applications

Recombinant CERS5 is engineered for in vitro studies to investigate ceramide synthesis pathways, apoptosis, and disease mechanisms. Key applications include:

  • Ceramide Biosynthesis Studies: Overexpression of recombinant CERS5 in cells increases C16:0-ceramide production, enabling analysis of sphingolipid metabolism .

  • Cancer Research: Used to study CerS5’s role in promoting apoptosis or chemoresistance in cancer cells (e.g., HCT116 colon cancer cells) .

  • Immune Modulation: Investigates CerS5’s impact on T-cell activation and cytokine production (e.g., IL-4, IFNγ, IL-17) .

Commercial Availability: Recombinant CERS5 is sold as a purified protein (e.g., catalog #MBS7011392 by MyBioSource) for biochemical assays and structural studies .

Metabolic and Physiological Roles

  • Obesity and Insulin Resistance: CERS5-deficient mice exhibit reduced C16:0-ceramide levels, leading to improved glucose homeostasis and resistance to diet-induced obesity .

  • Immune Function: CerS5 knockout mice show reduced intraepithelial CD8+ T-cells in the colon, impairing barrier integrity and increasing susceptibility to colitis and colon cancer .

Cancer-Related Pathways

  • Gastric Cancer Prognosis: High CerS5 expression correlates with poor survival in gastric cancer patients, particularly in Asian populations .

  • Mechanistic Insights: CerS5 overexpression promotes apoptosis in hypoxic conditions but may enhance tumor progression in certain contexts .

Table 2: CerS5 Expression and Clinical Correlations in Gastric Cancer

ParameterCerS5 ExpressionP-ValueSource
Tumor vs. Paracancerous Tissue38.4% vs. 14.1%<0.001
Lymph Node Metastasis29.3% vs. 14.1%0.010
5-Year Survival Rate32.8% (high) vs. 52.8% (low)<0.001

Independent Prognostic Factors

Multivariate Cox regression analysis identified CerS5 expression as an independent predictor of poor prognosis in gastric cancer, alongside N-stage, M-stage, and CA125 levels .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing the order, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
CERS5; LASS5; Ceramide synthase 5; CerS5; LAG1 longevity assurance homolog 5; Sphingoid base N-palmitoyltransferase CERS5; Sphingosine N-acyltransferase CERS5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CERS5
Target Protein Sequence
MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE
Uniprot No.

Target Background

Function
Ceramide synthase 5 catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, exhibiting high selectivity towards palmitoyl-CoA (hexadecanoyl-CoA; C16:0-CoA) (PubMed:16951403, PubMed:18541923, PubMed:22144673, PubMed:22661289, PubMed:23530041, PubMed:26887952, PubMed:29632068, PubMed:31916624). While capable of utilizing other acyl donors, the efficiency is lower. It N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively. Ceramide synthase 5 plays a crucial role in de novo ceramide synthesis and surfactant homeostasis in pulmonary epithelia.
Gene References Into Functions
  1. LASS5 interacts with SDHB and synergistically represses p53 and p21 activity. PMID: 27280497
  2. Studies have investigated the role of ceramide synthase 5 (LASS5 or CERS5) gene in atherosclerosis. Downregulation of LASS5 by siRNA has been shown to attenuate ceramide production and increase expression of certain AMPK target genes in HUVEC. This suggests that LASS5 is involved in the negative regulation of atherosclerosis-related genes, such as AMPK-alpha. PMID: 28424433
  3. mRNA levels of CerS5 are elevated in cancerous cell lines and decrease following the induction of apoptosis. PMID: 25779024
  4. Overexpression of CerS5 has been observed to increase apoptosis in HeLa cells. PMID: 20406683
  5. Research identifies LASS5 as a bona fide dihydroceramide synthase and demonstrates that mammalian dihydroceramide synthases do not require additional subunits for their activity. PMID: 16100120
  6. Accumulation of C(16)-ceramide in mitochondria, formed from the protein kinase C-dependent salvage pathway, is at least partially attributed to the action of longevity-assurance homologue 5. The generated ceramide modulates the p38 cascade via PP1. PMID: 17030510
  7. Down-regulation of either acid sphingomyelinase or LASS 5 has been shown to attenuate ceramide accumulation and H/R-induced Bax translocation to mitochondria. PMID: 18676372

Show More

Hide All

Database Links

HGNC: 23749

OMIM: 615335

KEGG: hsa:91012

STRING: 9606.ENSP00000325485

UniGene: Hs.270525

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of CERS5 in cellular metabolism?

CERS5 is an essential enzyme that maintains cellular C16:0 sphingolipid pools in multiple tissues including lung, spleen, muscle, liver, and white adipose tissue. It specifically catalyzes the N-acylation of sphingoid bases using C16:0-CoA as a substrate, thereby contributing to ceramide synthesis with specific acyl chain lengths. The substrate specificity for C16:0-CoA is determined within a 150-amino acid region of the TLC domain . CERS5 plays a crucial role in cellular sphingolipid homeostasis, which impacts membrane integrity, cell signaling pathways, and stress responses.

How does CERS5 interact with other ceramide synthases?

CERS5 forms both homodimers and heterodimers with other ceramide synthases. It has been demonstrated that CERS5 dimerizes with CERS2 and enhances CERS2 activity . This interaction between different ceramide synthases may provide a molecular mechanism for regulating the acyl chain composition of ceramides in various tissues. Experimental evidence suggests that dimerization modulates enzymatic activity, and co-expression studies demonstrate that catalytically inactive CERS5 mutants can act in a dominant-negative fashion to inhibit the activity of full-length CERS5 .

What are the optimal expression systems for studying recombinant CERS5?

When designing experiments with recombinant CERS5, researchers typically use mammalian expression systems such as HEK cells, as these maintain appropriate post-translational modifications and membrane targeting. Based on published methodologies, CERS5 constructs can be effectively expressed using vectors like PCMV with appropriate epitope tags (HA, FLAG) for detection and immunoprecipitation . When planning co-expression studies, it's advisable to use different epitope tags for each construct to facilitate separate identification and co-immunoprecipitation experiments. Transfection efficiency should be monitored and standardized to ensure consistent CERS5 expression levels across experimental replicates.

How should CERS5 knockout models be designed and validated?

The generation of CERS5 knockout models requires careful design and validation. Based on previous successful approaches, one effective strategy involves replacing the complete coding sequence with a reporter gene (such as NLS-lacZ) and a selectable marker (like a frt-flanked neomycin resistance gene). The targeting vector should contain homology arms flanking the coding sequence for proper homologous recombination .

Validation of CERS5 knockout models should include:

  • PCR screening for correct homologous recombination

  • Southern blotting to confirm targeting vector integration

  • Western blotting using specific antibodies to confirm absence of CERS5 protein

  • Lipidomic analysis to verify altered sphingolipid profiles, particularly decreased C16:0-ceramide levels in relevant tissues

What controls are essential when studying CERS5 dimerization and its effects on enzymatic activity?

When investigating CERS5 dimerization and its effects on enzymatic activity, several controls are crucial:

  • Expression level controls: Maintain consistent expression levels of all constructs, verified by Western blotting

  • Activity controls: Include wild-type CERS5 alone to establish baseline enzymatic activity

  • Interaction controls: Use catalytically inactive mutants (such as CERS5 ΔC332–392) to distinguish between dimerization and activity effects

  • Specificity controls: Test interaction with non-CerS membrane proteins to confirm specificity of observed interactions

  • Quantitative controls: Establish dose-dependency by transfecting increasing amounts of interaction partners

These controls help distinguish between effects on protein stability, localization, and intrinsic enzymatic activity when interpreting results from co-expression studies.

How is CERS5 expression altered in cancer, and what are the implications for patient prognosis?

CERS5 expression is significantly altered in several cancer types, with important implications for patient prognosis. In gastric cancer, CerS5 is consistently overexpressed in primary tumor tissues and metastatic lymph nodes compared to normal tissues . High expression of CERS5 is significantly correlated with poor prognosis in gastric cancer patients, particularly in Asian populations. The 5-year survival rate for patients with high CerS5 expression (32.8%) is considerably lower than for those with low expression (52.8%) .

Similar patterns have been observed in other cancers:

  • Colorectal cancer shows upregulated CERS5 mRNA expression

  • Neuroglioma tissues exhibit significantly higher CERS5 levels than normal nervous ganglion tissues

  • Endometrial cancer demonstrates overexpression of CERS5 mRNA

Multivariate analysis confirms CERS5 expression as an independent prognostic factor in gastric cancer, alongside other clinicopathological features such as Lauren classification, N stage, M stage, and CA125 levels .

What is the relationship between CERS5 expression and clinicopathological features in cancer patients?

The relationship between CERS5 expression and clinicopathological features has been most thoroughly investigated in gastric cancer. Statistical analyses reveal significant correlations between CERS5 expression levels and:

ParametersAssociation with CERS5Statistical Significance
Tumor locationCorrelatedSignificant
CA50 levelsCorrelatedSignificant
Patient prognosisNegative correlationP=0.023 (univariate), P=0.046 (multivariate)
Lauren classificationAssociatedP=0.015 (univariate), P=0.022 (multivariate)

Interestingly, while CERS5 expression is a significant prognostic factor in Asian populations (both in direct studies and ACRG database), this correlation was not observed in the TCGA database, which primarily contains data from European populations. This suggests potential ethnic or population-specific effects of CERS5 in cancer progression .

How does CERS5 affect response to therapy in cancer models?

CERS5 plays a significant role in modulating cellular responses to therapeutic interventions. In cancer models, CERS5 has been implicated in:

  • Radiation response: CERS5 regulates post-mitochondrial events during apoptosis in response to UV radiation, working cooperatively with CERS6. It increases apoptosis in response to ionizing radiation in cancer cell lines .

  • Chemotherapy sensitivity: Knockdown of CERS5 using specific shRNA inhibits autophagy and increases drug sensitivity of colorectal cancer cells to chemotherapeutics like oxaliplatin and 5-FU .

  • Ceramide-mediated apoptosis: CERS5 and CERS6 together are responsible for radiation-induced C16:0-ceramide production in mitochondrion-associated endoplasmic reticulum membranes, eventually leading to mitochondrial ceramide accumulation and cell death .

These findings suggest that CERS5 could be a potential therapeutic target, particularly in cancers where its expression is elevated. Modulating CERS5 activity might enhance the efficacy of existing cancer treatments.

What are the most effective methods for measuring CERS5 enzymatic activity?

When measuring CERS5 enzymatic activity, researchers should consider several methodological approaches based on experimental objectives:

For cell-free assays:

  • Use microsomal preparations from cells expressing recombinant CERS5

  • Include appropriate sphingoid base substrate (typically sphinganine)

  • Supply acyl-CoA donor (preferably C16:0-CoA for CERS5)

  • Incorporate radioactive or fluorescent labels for product detection

  • Include proper negative controls (heat-inactivated enzyme, competitive inhibitors)

For cellular assays:

  • Transfect cells with CERS5 expression constructs

  • Supply cell-permeable sphingoid base precursors

  • Analyze ceramide production using mass spectrometry or TLC

  • Compare results with CerS5-knockout or knockdown controls

Quantification methods should include liquid chromatography tandem-mass spectrometry (LC-MS/MS) for precise measurement of specific ceramide species. This approach has been effectively used to quantify ceramide levels in various tissue samples, including cancer tissues .

How can researchers effectively distinguish between the activities of different ceramide synthases in complex biological samples?

Distinguishing between different ceramide synthases in complex biological samples presents a significant challenge due to overlapping substrate preferences. A comprehensive approach includes:

  • Acyl-CoA specificity profiling: CERS5 preferentially utilizes C16:0-CoA, while other CerS family members have different chain length preferences (e.g., CERS2 prefers very-long-chain acyl-CoAs).

  • Selective inhibition: Use selective inhibitors or competitive substrates that differentially affect CerS isoforms.

  • Genetic approaches: Implement selective knockdown or knockout of specific CerS family members, followed by comprehensive lipidomic analysis to identify changes in specific ceramide species.

  • Expression correlation: Correlate enzyme activity with protein expression levels using isoform-specific antibodies.

  • Heterologous expression: Express individual recombinant CerS enzymes in systems lacking endogenous ceramide synthase activity to establish baseline activities and substrate preferences.

This multifaceted approach allows researchers to attribute observed changes in ceramide profiles to specific CerS isoforms, particularly in tissues expressing multiple CerS family members .

What technical considerations are important when analyzing CERS5 protein-protein interactions?

When analyzing CERS5 protein-protein interactions, several technical considerations are crucial:

Research demonstrates that CERS5 forms functionally relevant homo- and heterodimers, and appropriate technical approaches are essential for accurately characterizing these interactions .

What are the emerging roles of CERS5 in metabolic disorders?

Recent investigations have uncovered potential roles for CERS5 in metabolic disorders, particularly related to obesity and insulin resistance. CERS5 knockout mice have been used to study the effect of CERS5 deficiency on the development of obesity and insulin resistance after high-fat diet challenges . These studies suggest that altered C16:0 sphingolipid pools in tissues like white adipose tissue, liver, and muscle may influence metabolic pathways related to lipid storage, glucose tolerance, and insulin sensitivity.

The role of CERS5 in maintaining specific ceramide pools in metabolically active tissues suggests it may be a potential therapeutic target in metabolic disorders. Research is ongoing to determine whether selective inhibition of CERS5 could provide metabolic benefits without disrupting essential cellular functions.

How do CERS5 genetic variants influence enzyme function and disease susceptibility?

While comprehensive studies on CERS5 genetic variants are still emerging, structural and functional studies provide insights into how variations might impact enzyme function:

  • Variants affecting the TLC domain (especially within the 150-amino acid region determining substrate specificity) may alter the acyl-CoA chain length preference, potentially shifting the ceramide profile.

  • Mutations in the regions encoding the two positively charged amino acids after the homeodomain would likely impair catalytic activity, as these residues are essential for enzymatic function .

  • Variants affecting the C-terminal transmembrane domain could disrupt proper membrane integration or protein folding, potentially creating dominant-negative effects as observed with truncated CERS5 constructs .

Future genome-wide association studies may reveal specific CERS5 variants associated with disease susceptibility, particularly in conditions where ceramide metabolism is implicated, such as cancer, metabolic disorders, and neurodegenerative diseases.

What are the current contradictions or knowledge gaps in CERS5 research that require further investigation?

Several significant knowledge gaps and contradictions in CERS5 research warrant further investigation:

  • Population-specific effects: The discrepancy between CERS5 prognostic value in Asian (ACRG database) versus European (TCGA database) gastric cancer populations requires clarification. This suggests potential ethnic variations in CERS5 biology or interactions with genetic or environmental factors .

  • Dual roles in cancer: CERS5 appears to have context-dependent effects in cancer. It promotes apoptosis in response to radiation and hypoxia/reoxygenation, yet its overexpression correlates with poor prognosis in several cancers . This apparent contradiction requires mechanistic clarification.

  • Regulatory mechanisms: The transcriptional, post-transcriptional, and post-translational mechanisms regulating CERS5 expression and activity remain poorly understood.

  • Precise subcellular localization: While CERS5 operates in the ER, its precise localization to specific ER subdomains and potential translocation under stress conditions requires further investigation.

  • Comprehensive in vivo characterization: Despite extensive biochemical characterization and knockdown studies, comprehensive in vivo characterization of CERS5 function in various physiological and pathological contexts remains incomplete .

Addressing these knowledge gaps will provide a more complete understanding of CERS5 biology and its potential as a therapeutic target in various diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.