Recombinant Human Chemokine XC receptor 1 (XCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
XCR1; CCXCR1; GPR5; Chemokine XC receptor 1; G-protein coupled receptor 5; Lymphotactin receptor; XC chemokine receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY
Uniprot No.

Target Background

Function
XCR1 acts as a receptor for chemokines SCYC1 and SCYC2, subsequently transducing a signal by elevating intracellular calcium ion levels. It also serves as a receptor for XCL1/Lymphotactin.
Gene References Into Functions
  1. Our research provides a foundation for further investigation into the molecular mechanism by which XCR1 downregulation contributes to the development and progression of hepatocellular carcinoma. PMID: 29408492
  2. This study demonstrates equivalence between human and mouse XCR1(+) dendritic cells and human and mouse Langerhans cells. PMID: 26966045
  3. The findings indicate that XCR1 represents a novel potential therapeutic target for the management of lung cancer bone metastasis. PMID: 26166822
  4. The study demonstrates the induction of potent CD8 T cell cytotoxicity through specific targeting of antigen to cross-presenting dendritic cells in vivo via murine or human XCR1. PMID: 25520399
  5. XCR1 expression is observed early during tumorigenic transformation and contributes to enhanced cell migration and proliferation, facilitating the prometastatic behavior of epithelial ovarian cancer cells. PMID: 22964431
  6. CD8alpha-positive dendritic cells (DCs) and CD103-positive DCs are part of a common DC subset unequivocally identified by XCR1 transgene expression despite their distinct anatomical locations. PMID: 21948982
  7. The findings suggest that genetic variability in the G-Protein-Coupled Receptor Kinase 5 and Casein Kinase 2 genes does not influence Parkinson disease susceptibility. PMID: 21514207
  8. XCR1 expression and specific VH gene usage are distinctive characteristics of diffuse large B-cell lymphoma initially presenting in the bone marrow. PMID: 21411777
  9. The expression patterns of XCR1 and XCL1 were conserved in human and mouse blood cells, including specific dendritic cell subsets. PMID: 20541533
  10. CD141+ dendritic cells are the only cells in human blood that express the chemokine receptor XCR1 and respond to the specific ligand XCL1 by Ca2+ mobilization and potent chemotaxis. PMID: 20479115
  11. XCR1 serves as the first conserved specific marker for cell subsets homologous to mouse CD8alpha+ dendritic cells in higher vertebrates. PMID: 20479118
  12. Data indicate that Kaposi sarcoma-associated herpes virus targets the lymphotactin receptor with both a broad spectrum antagonist vCCL2 and a highly selective and potent agonist vCCL3. PMID: 17403668
  13. vCCL3 (Kaposi sarcoma- associated herpes virus), mouse XCL1 and XCL1 act as agonists on the human XCR1. PMID: 18426556

Show More

Hide All

Database Links

HGNC: 1625

OMIM: 600552

KEGG: hsa:2829

STRING: 9606.ENSP00000310405

UniGene: Hs.128375

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is XCR1 and what is its primary function in the immune system?

XCR1 is the X-C motif chemokine receptor 1, a G protein-coupled receptor that selectively binds to the chemokine XCL1. It is highly expressed in conventional dendritic cells subtype 1 (cDC1s) and is crucial for their activation. The primary function of XCR1 in the immune system is to facilitate the cross-presentation of antigens to CD8+ T cells, which is essential for initiating cytotoxic immune responses against viral infections and tumors . This receptor-ligand interaction creates a communication channel between CD8+ T cells, which produce XCL1, and the cDC1s that express XCR1, enabling efficient cytotoxic T cell responses .

XCR1 is also involved in the cross-talk between natural killer (NK) cells and cDC1s. Both NK cells and CD8+ T cells selectively express XCL1, which enhances their interaction with XCR1-expressing dendritic cells. This interaction is part of a sophisticated immune surveillance system that detects and responds to cellular abnormalities, particularly in the context of cancer and viral infections . The evolutionary conservation of this system across mammals underscores its fundamental importance in adaptive immunity.

How is XCR1 expression distributed across different cell types?

XCR1 expression is remarkably restricted in the immune system. The receptor is selectively expressed on conventional dendritic cells, particularly the CD8α+ DC subset in mice, BDCA3+ DCs in humans, and CD26+ DCs in sheep . This consistent pattern across species highlights the evolutionarily conserved nature of XCR1 as a specific marker for this DC subset. Using techniques such as intron-spanning RT-PCR and reporter mouse models, researchers have conclusively demonstrated that XCR1 mRNA is not expressed in resting or activated T cells, B cells, NK cells, or plasmacytoid DCs (pDCs) .

Single-cell RNA sequencing data has further refined our understanding of XCR1 expression patterns. Analysis from public single-cell databases, including datasets from non-small cell lung cancer (NSCLC) and uterine corpus endometrial carcinoma (UCEC), confirms that XCR1 is primarily expressed in infiltrating dendritic cells within tumor tissues . Interestingly, some malignant cells also express XCR1, though at generally lower levels compared to the adjacent normal tissues across multiple cancer types including liver hepatocellular carcinoma (LIHC), lung adenocarcinoma (LUAD), and head and neck squamous cell carcinoma (HNSC) .

What is the relationship between XCR1 and its ligand XCL1?

The relationship between XCR1 and its ligand XCL1 represents a specialized chemokine-receptor interaction that facilitates immune cell communication. XCL1 is uniquely produced by activated NK cells and CD8+ T cells, particularly memory CD8+ T cells that can rapidly release high levels of this chemokine upon stimulation . This selective expression pattern creates a dedicated communication channel between cytotoxic lymphocytes and cDC1s. XCL1 and its closely related paralog XCL2 are distinctive among chemokines for having a single disulfide bond, which differentiates them structurally from other chemokines .

Functional studies have demonstrated that XCL1 induces strong chemotaxis of murine CD8+ DCs but not other DC subtypes or lymphocytes, confirming the highly specific nature of this receptor-ligand pair . In vivo experiments with XCL1 gene-deficient mice have shown that the XCL1-XCR1 axis optimizes the expansion and survival of CD8+ T cells and their differentiation into cytotoxic effectors . During viral infections, both in mice and humans, XCL1 expression is further induced in NK and CD8+ T cells, reinforcing the importance of this signaling axis in antiviral immunity .

How conserved is XCR1 across different species?

XCR1 exhibits remarkable evolutionary conservation across mammalian species, functioning as a specific marker for homologous DC subsets. Research has confirmed that XCR1 is selectively expressed and functionally active in mouse CD8α+ DCs, human BDCA3+ DCs, and sheep CD26+ DCs . This conservation extends beyond mammals, as the gene encoding XCL1 (the ligand for XCR1) is present and well conserved in all higher vertebrates from reptiles to humans .

Functional studies demonstrate that this conservation is not merely structural but extends to biological activity. Transwell migration assays have shown that XCL1 induces specific migration of CD8α+-type DCs in mice, BDCA3+ DCs in humans, and CD26+ DCs in sheep . Importantly, genetic studies using XCR1−/− mice confirm that this receptor is required for DC responses to XCL1, confirming the specificity of this interaction across species. This evolutionary conservation suggests an ancient and fundamental role for the XCL1-XCR1 axis in vertebrate immunity, particularly in the cross-talk between cytotoxic lymphocytes and specialized antigen-presenting cells.

What are the key structural features of XCR1?

Recent advances in structural biology have revealed the molecular architecture of XCR1 and its interaction with XCL1. Cryo-electron microscopy studies have determined a high-resolution structure of the human XCR1 in complex with G protein and an engineered form of XCL1 called XCL1 CC3 . This structure has elucidated several key features of XCR1. As a G protein-coupled receptor, XCR1 has the characteristic seven-transmembrane domain structure common to this receptor family. The binding of XCL1 to XCR1 induces conformational changes that activate G protein signaling pathways.

The binding pocket of XCR1 contains unique structural arrangements that confer specificity for XCL1. Particularly important is the N-terminal segment of XCL1, which is vital for activating XCR1 . Mutagenesis studies combined with structural analysis have revealed the molecular details of this interaction, identifying key residues at the bottom of the XCL1 binding pocket that undergo structural alterations during receptor activation. These structural insights are crucial for understanding how XCL1 specifically binds to and activates XCR1, providing a foundation for the rational design of XCR1 modulators that could enhance anti-tumor immunity by potentiating XCR1 signaling in the tumor microenvironment .

What methodologies are most effective for studying XCR1 expression in dendritic cells?

The accurate detection and analysis of XCR1 expression in dendritic cells requires specialized methodologies due to its restricted expression pattern and relatively low abundance. For mRNA detection, intron-spanning RT-PCR using poly(A) RNA has proven effective in overcoming initial difficulties in detecting XCR1 transcripts . This approach takes advantage of the murine XCR1 gene structure, which contains two exons, allowing for the design of primers that span the intron and minimize genomic DNA contamination. Quantitative PCR and RNA sequencing provide quantitative measures of XCR1 expression across different cell types and conditions.

Functional assays, particularly transwell migration assays using recombinant XCL1, provide a complementary approach to identify cells with active XCR1 receptors . Single-cell RNA sequencing has emerged as a powerful tool for comprehensively mapping XCR1 expression across heterogeneous cell populations, particularly in complex tissues such as tumors . These methodological approaches should be combined for a comprehensive assessment of XCR1 expression and function.

How does XCR1 signaling contribute to dendritic cell function in cross-presentation?

XCR1 signaling plays a critical role in optimizing the cross-presentation function of cDC1s, which is essential for initiating CD8+ T cell responses against viruses and tumors. The XCL1-XCR1 axis creates a positive feedback loop between activated CD8+ T cells and cDC1s. When CD8+ T cells recognize antigen, they upregulate XCL1 production, which attracts and activates XCR1-expressing cDC1s . This interaction enhances the cDC1's ability to capture, process, and present antigens on MHC class I molecules to CD8+ T cells.

Experimental evidence from XCR1-deficient mice demonstrates the functional importance of this pathway. When challenged with Listeria monocytogenes expressing the ovalbumin antigen (Lm-OVA), XCR1−/− mice exhibited significantly fewer antigen-specific CD8+ T cells compared to wild-type animals, resulting in higher bacterial loads early after infection . This indicates that XCR1 activity in CD8α+ DCs is necessary for efficient induction of antigen-specific CD8+ T cell responses and pathogen control.

Mechanistically, XCR1 signaling likely enhances multiple aspects of the cross-presentation pathway, including antigen acquisition, processing, and presentation. The XCR1-expressing cDC1s also express other specialized molecules for cross-presentation, including the endocytic receptor CLEC9A, which promotes cross-presentation of antigens derived from dying cells, and the adhesion receptor CADM1, which may promote the induction of CTL responses . Together, these molecular tools equip cDC1s for their specialized role in cross-presentation and cytotoxic T cell priming.

What are the implications of XCR1 in cancer immunotherapy research?

XCR1 has emerged as a promising target for cancer immunotherapy due to its specific expression on cDC1s and its crucial role in anti-tumor immunity. Pan-cancer analysis has revealed that XCR1 expression is often downregulated in tumors compared to adjacent normal tissues across multiple cancer types, including liver hepatocellular carcinoma (LIHC), lung adenocarcinoma (LUAD), and head and neck squamous cell carcinoma (HNSC) . This downregulation correlates with worse prognosis and decreased immune cell infiltration, particularly DCs and CD8+ T cells, suggesting that tumors may suppress XCR1 expression as an immune evasion mechanism.

Gene enrichment studies indicate that XCR1 enhances immune system performance by promoting T-cell infiltration through the C-X-C Motif Chemokine Ligand 9 (CXCL9)-C-X-C Motif Chemokine Receptor 3 (CXCR3) axis . This positions XCR1 as a central player in coordinating multiple chemokine pathways that shape the tumor immune microenvironment. Therapeutic approaches targeting XCR1 could potentially enhance the recruitment and function of cDC1s in the tumor microenvironment, leading to improved CD8+ T cell responses against cancer cells.

How can XCR1 be targeted for enhancing anti-tumor immunity?

Targeting XCR1 for enhancing anti-tumor immunity represents a promising yet challenging frontier in cancer immunotherapy. Based on our understanding of XCR1 biology, several strategic approaches can be considered. One approach is the development of XCR1 agonists that mimic or enhance the effects of natural XCL1. The recent cryo-electron microscopy structure of the XCR1-XCL1-Gi protein complex provides a molecular blueprint for designing optimized XCR1 modulators . By identifying key residues involved in receptor activation, researchers can develop small molecules or peptide mimetics that selectively activate XCR1 signaling.

Another approach involves engineering tumor-targeting constructs that incorporate XCL1 to attract XCR1-expressing cDC1s to the tumor microenvironment. This strategy could enhance the capture of tumor antigens by cDC1s and their subsequent cross-presentation to CD8+ T cells. Additionally, combination therapies that pair XCR1 targeting with other immunotherapeutic approaches, such as checkpoint inhibitors, could synergistically enhance anti-tumor immune responses.

In vitro generated XCR1+ dendritic cells represent another promising tool for cancer immunotherapy. Optimized protocols for generating high numbers of human XCR1+ DCs from CD34+ hematopoietic progenitors have been developed . These in vitro-derived XCR1+ DCs closely resemble their naturally occurring counterparts and express the key functional molecules characteristic of cDC1s, including XCR1, CLEC9A, CADM1, and TLR3. These cells could be loaded with tumor antigens ex vivo and reinfused into patients to enhance anti-tumor immune responses.

What are the current challenges in developing XCR1-targeted therapeutics?

The development of XCR1-targeted therapeutics faces several significant challenges despite its promising potential. A primary challenge is the highly restricted expression pattern of XCR1, which is predominantly limited to a rare subset of dendritic cells. While this specificity reduces the risk of off-target effects, it also means that therapeutic agents must be extremely potent and efficient to achieve meaningful biological effects. Additionally, the relatively low expression levels of XCR1, as indicated by the low Transcripts Per Million (TPM) values observed in transcriptomic data across various tissues , may necessitate highly sensitive detection methods for monitoring therapeutic responses.

The dynamic nature of XCR1 expression in the tumor microenvironment presents another challenge. Pan-cancer analysis has shown that XCR1 expression is often downregulated in tumors compared to adjacent normal tissues , suggesting that tumors may actively suppress XCR1 as an immune evasion mechanism. Therapeutic strategies must overcome this suppression to effectively restore XCR1 signaling and enhance anti-tumor immunity.

From a structural perspective, designing agents that specifically modulate XCR1 activity requires a detailed understanding of its activation mechanism. While recent structural studies have elucidated the molecular basis for XCL1 recognition and XCR1 activation , translating these insights into effective therapeutics remains challenging. The complexity of G protein-coupled receptor pharmacology, including issues of biased signaling, receptor desensitization, and internalization, adds further layers of complexity to therapeutic development. Despite these challenges, the potential of XCR1-targeted approaches to enhance anti-tumor immunity continues to drive research in this promising field.

How does XCR1 expression correlate with patient survival in various cancer types?

The prognostic value of XCR1 expression appears to be linked to its role in immune surveillance within the tumor microenvironment. Patients with reduced XCR1 expression show worse prognoses and a concomitant decrease in immune cell infiltration, particularly dendritic cells and CD8+ T cells . This suggests that XCR1-expressing cells play a crucial role in orchestrating effective anti-tumor immune responses. The mechanistic basis for this correlation may involve the ability of XCR1-expressing cDC1s to cross-present tumor antigens to CD8+ T cells, thereby initiating and sustaining cytotoxic T cell responses against cancer cells.

Receiver operating characteristic (ROC) analysis has further validated the potential of XCR1 as a prognostic biomarker in cancer. These findings highlight the importance of XCR1 in remodeling the tumor microenvironment and suggest its potential utility as a biomarker for predicting response to immunotherapy. The consistent association between XCR1 expression and survival across diverse cancer types underscores its fundamental role in anti-tumor immunity.

What experimental models are most appropriate for studying XCR1 function in vivo?

Several experimental models have proven valuable for investigating XCR1 function in vivo, each with distinct advantages for addressing specific research questions. Genetically modified mouse models, particularly XCR1-deficient (XCR1−/−) mice, have been instrumental in defining the functional importance of XCR1 in immune responses. Studies with these mice have demonstrated reduced CD8+ T cell responses to Listeria monocytogenes infection and higher bacterial loads, confirming the critical role of XCR1 in protective immunity . XCR1 reporter mice, where lacZ is expressed under the control of the XCR1 promoter, have facilitated the visualization of XCR1-expressing cells in tissues through histological analysis .

For studying human XCR1 biology, humanized mouse models and in vitro systems using human cells are valuable alternatives. An optimized protocol for generating high numbers of human XCR1+ dendritic cells from CD34+ hematopoietic progenitors has been developed, providing a reliable source of XCR1+ cells for functional studies . These in vitro-derived XCR1+ dendritic cells closely resemble naturally occurring XCR1+ blood dendritic cells in their transcriptional profile and functional properties.

Patient-derived xenograft (PDX) models, where human tumor samples are implanted into immunodeficient mice, can be used to study the role of XCR1 in the tumor microenvironment. These models can be further enhanced by humanizing the immune system, allowing for the investigation of interactions between human XCR1+ dendritic cells and human T cells in the context of cancer. Single-cell RNA sequencing of tumor samples, both from patients and experimental models, provides a powerful approach for analyzing XCR1 expression patterns and correlating them with immune cell infiltration and tumor progression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.