Recombinant Human Chloride channel CLIC-like protein 1 (CLCC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CLCC1; KIAA0761; MCLC; Chloride channel CLIC-like protein 1; Mid-1-related chloride channel protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-551
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKI DECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGDMHYDAEIILKRETLLEIQ KFLNGEDWKPGALDDALSDILINFKFHDFETWKWRFEDSFGVDPYNVLMVLLCLLCIVVL VATELWTYVRWYTQLRRVLIISFLFSLGWNWMYLYKLAFAQHQAEVAKMEPLNNVCAKKM DWTGSIWEWFRSSWTYKDDPCQKYYELLLVNPIWLVPPTKALAVTFTTFVTEPLKHIGKG TGEFIKALMKEIPALLHLPVLIIMALAILSFCYGAGKSVHVLRHIGGPESEPPQALRPRD RRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKS PEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKETGGILGEGTPKESSTESSQSAKPVS GQDTSGNTEGSPAAEKAQLKSEAAGSPDQGSTYSPARGVAGPRGQDPVSSPCG
Uniprot No.

Target Background

Function
Functions as a chloride ion channel and plays a role in retinal development.
Database Links

HGNC: 29675

OMIM: 617539

KEGG: hsa:23155

STRING: 9606.ENSP00000349456

UniGene: Hs.658489

Protein Families
Chloride channel MCLC family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the retina of the eye, with extensive expression in the lamina cribrosa, optic nerve, ganglion cell layer, inner nuclear layer, outer nuclear layer and retinal pigment epithelium.

Q&A

What is CLCC1 and where is it localized in cells?

CLCC1 (Chloride channel CLIC-like protein 1) is an ER-resident protein that functions as a pore-forming component of an endoplasmic reticulum anion channel. Despite its name suggesting similarity to the CLIC family, CLCC1 has little sequence homology with CLIC family members or other known ion channels . The protein is widely expressed across tissues, as demonstrated by Western blot analysis, with significant presence in the central nervous system including cerebellum, hippocampus, cerebral cortex, and spinal cord . CLCC1 is specifically localized to the endoplasmic reticulum membrane where it maintains chloride and other ion homeostasis within the ER lumen.

How does CLCC1 function as an ion channel?

CLCC1 functions as an ER anion channel with high permeability to anions, particularly chloride ions. The channel activity of CLCC1 has been confirmed through incorporation of purified CLCC1 into lipid bilayers, demonstrating that it directly forms an ion-conducting pore rather than merely regulating other channels . CLCC1 forms homomultimers in the ER membrane, as evidenced by native gel experiments showing complex formations of approximately 180 kD and 360 kD for purified full-length CLCC1, with the 360 kD band being the major component for endogenous CLCC1 . The channel's activity is inhibited by luminal Ca²⁺ but facilitated by phosphatidylinositol 4,5-bisphosphate (PIP2), with specific conserved residues mediating these regulatory interactions .

What are the key regulatory mechanisms controlling CLCC1 channel activity?

CLCC1 channel activity is regulated through several key mechanisms:

  • Calcium-dependent inhibition: Luminal Ca²⁺ inhibits CLCC1 channel open probability. The conserved residues D25 and D181 in the CLCC1 N-terminus are responsible for Ca²⁺ binding and this inhibitory effect .

  • PIP2 facilitation: Phosphatidylinositol 4,5-bisphosphate (PIP2) facilitates CLCC1 channel activity. The residue K298 in the CLCC1 intraluminal loop has been identified as the critical PIP2-sensing residue .

  • Multimerization: CLCC1 forms homomultimeric complexes in the ER membrane, which is essential for its proper functioning as an ion channel. Chromatographic column separation of purified full-length mouse CLCC1 revealed a major high molecular weight peak, supporting the multimerization model .

These regulatory mechanisms allow for precise control of chloride homeostasis in the ER, which is crucial for proper protein folding and ER function.

How is CLCC1 linked to amyotrophic lateral sclerosis (ALS)?

CLCC1 has been directly linked to amyotrophic lateral sclerosis (ALS) through multiple lines of evidence. Rare variants of the CLCC1 gene have been identified in ALS patients, and these mutations impair channel conductance . In animal models, approximately 10% of K298A heterozygous mice (with mutation in the PIP2-sensing residue) developed ALS-like symptoms, pointing to a mechanism of channelopathy dominant-negatively induced by a loss-of-function mutation .

Furthermore, conditional knockout of Clcc1 in mice cell-autonomously causes motor neuron loss, ER stress, misfolded protein accumulation, and characteristic ALS pathologies in the spinal cord . These findings collectively support that disruption of ER ion homeostasis maintained by CLCC1 contributes significantly to ALS-like pathologies. The discovery of the molecular mechanism linking ion channel dysfunction to neurodegeneration provides new potential therapeutic avenues for ALS treatment.

What is the relationship between CLCC1 dysfunction and ER stress?

CLCC1 dysfunction leads to ER stress through disruption of chloride homeostasis within the ER lumen. When CLCC1 function is impaired, either through mutations or decreased expression, the resulting ion imbalance compromises the protein-folding capacity of the ER . This triggers the unfolded protein response (UPR) signaling pathway.

In Clcc1-deficient neurons, GRP78 (the major HSP70 family chaperone in the ER) is upregulated, indicating activation of the UPR . Additionally, ubiquitinated proteins accumulate in these neurons before their degeneration, suggesting compromised protein quality control . While acute UPR activation is protective, prolonged UPR activity associated with chronic CLCC1 dysfunction leads to neuronal cell death in multiple pathological conditions .

This connection between chloride channel function and ER proteostasis reveals a previously underappreciated aspect of ER biology, where ion homeostasis directly impacts protein folding and cell survival.

What cerebellar pathologies are associated with CLCC1 mutations?

CLCC1 mutations have been linked to specific cerebellar pathologies, particularly affecting granule cells. A spontaneous recessive mouse mutation in the Clcc1 gene causes progressive cerebellar granule cell death . This mutation was identified as a retrotransposon insertion that dramatically reduces normal CLCC1 expression.

The C3H/HeSnJ inbred mouse strain, which carries this mutation, exhibits late onset cerebellar degeneration characterized by ataxia . The cerebellar degeneration is progressive and specifically affects granule cells. This selective vulnerability of cerebellar granule cells to CLCC1 dysfunction suggests a particularly important role for chloride homeostasis in these neurons.

In complementation studies, transgenic expression of wild-type Clcc1 rescued the cerebellar degeneration phenotype, confirming that the Clcc1 mutation is indeed responsible for the observed pathology .

How can researchers effectively express and purify recombinant CLCC1 for functional studies?

For effective expression and purification of recombinant CLCC1, researchers should consider the following methodology:

  • Expression system selection: While bacterial systems (E. coli) are commonly used for recombinant protein production, membrane proteins like CLCC1 may require eukaryotic expression systems such as insect cells or mammalian cells to ensure proper folding and post-translational modifications.

  • Construct design: Include an affinity tag (His-tag, FLAG-tag) for purification purposes, and consider using a fusion partner to improve solubility. For CLCC1 specifically, preserving the N-terminal region containing D25 and D181 residues is crucial as they are responsible for Ca²⁺ binding .

  • Purification strategy: Use a combination of affinity chromatography, ion exchange, and size exclusion chromatography. For CLCC1, size exclusion is particularly important to isolate the functional multimeric forms (~180 kD and ~360 kD) .

  • Functional verification: After purification, confirm activity by incorporating the protein into lipid bilayers and performing electrophysiological measurements to assess chloride conductance. Test for calcium sensitivity and PIP2 modulation to verify proper functioning .

For structural studies, maintaining the native multimeric state is essential, as chromatographic column separation of purified full-length mouse CLCC1 reveals a major high molecular weight peak corresponding to the multimeric complex .

What are effective methods to study CLCC1's role in ER stress responses?

To study CLCC1's role in ER stress responses, researchers can employ multiple complementary approaches:

  • Genetic manipulation strategies:

    • CRISPR-Cas9 knockout or knockdown of CLCC1 in cell culture models

    • Conditional knockout mice (as used in studies showing motor neuron loss)

    • Expression of mutant forms (e.g., D25A, D181A, or K298A) to study specific regulatory mechanisms

  • ER stress assessment:

    • Monitor UPR markers (GRP78/BiP, CHOP, XBP1 splicing) via Western blot, qPCR, or reporter assays

    • Measure accumulation of ubiquitinated proteins as indicators of impaired protein quality control

    • Analyze protein aggregation using immunofluorescence or biochemical fractionation

  • Functional assays:

    • Measure ER chloride concentration using chloride-sensitive fluorescent probes

    • Assess ER calcium dynamics, as CLCC1 dysfunction affects ER calcium homeostasis

    • Evaluate cell survival under conditions of induced ER stress (e.g., tunicamycin or thapsigargin treatment)

  • Rescue experiments:

    • Complement genetic deficiencies with wild-type CLCC1 expression to confirm specificity

    • Test CLCC1 variants to map functional domains important for ER stress protection

These approaches can be combined to provide comprehensive insights into how CLCC1 regulates ER proteostasis and stress responses.

What technical considerations are important when designing experiments to study CLCC1 channel conductance?

When designing experiments to study CLCC1 channel conductance, several technical considerations are crucial:

  • Lipid bilayer composition: The lipid environment significantly affects channel properties. Include physiologically relevant phospholipids, particularly PIP2, which facilitates CLCC1 channel activity through interaction with the K298 residue .

  • Ion concentration gradients: Design experiments with appropriate chloride gradients across the membrane to accurately measure channel conductance. Consider including other physiologically relevant ions to assess selectivity.

  • Calcium concentration control: Maintain precise control over calcium levels, as luminal Ca²⁺ inhibits CLCC1 channel open probability through interaction with D25 and D181 residues . Systematically vary calcium concentrations to determine dose-dependent effects.

  • Protein reconstitution method: The method of incorporating CLCC1 into lipid bilayers can affect channel properties. Consider both artificial liposomes and ER-derived microsomes for comprehensive characterization.

  • Electrophysiological recording techniques:

    • Single-channel patch-clamp to measure unitary conductance

    • Planar lipid bilayer recordings for reconstituted proteins

    • Whole-cell patch-clamp with ER membrane targeted approaches

  • Mutagenesis controls: Include CLCC1 mutants affecting key residues (D25, D181, K298) as controls to validate the specificity of recorded currents .

These considerations ensure accurate and physiologically relevant characterization of CLCC1 channel properties.

How does CLCC1 interact with viral lifecycle machinery, particularly in herpesviruses?

CLCC1 plays a crucial role in herpesvirus nuclear egress, particularly during the membrane fusion stage. Recent research using a whole-genome CRISPR-Cas9 screen identified CLCC1 as the top hit for proteins required for herpes simplex virus 1 (HSV-1) nuclear egress .

Mechanistically, CLCC1 is essential for the fusion stage of HSV-1 nuclear egress. Loss of CLCC1 results in:

  • Defects in HSV-1 nuclear egress

  • Accumulation of capsid-containing perinuclear vesicles

  • Significant reduction in viral titers

This phenotype extends beyond HSV-1 to other alphaherpesviruses, as CLCC1 knockout also decreased viral titers in herpes simplex virus 2 (HSV-2) and pseudorabies virus (PRV) . Importantly, expression of wild-type CLCC1 in trans rescued these defects, confirming the specificity of CLCC1's role.

The mechanism appears to be related to CLCC1's role in membrane fusion, as loss of CLCC1 in uninfected cells induces a phenotype associated with defects in nuclear pore complex (NPC) insertion . This suggests CLCC1 may be involved in cellular membrane fusion events that are co-opted by herpesviruses during their lifecycle.

What is the structural basis for CLCC1's ion selectivity and regulation?

The structural basis for CLCC1's ion selectivity and regulation involves specific domains and residues that have been identified through functional studies:

  • Ion selectivity determinants: Although complete structural information is limited, functional studies indicate CLCC1 has high permeability to anions, particularly chloride . Unlike some chloride channels, CLCC1 has little sequence similarity with CLIC family members or other known ion channels, suggesting a novel structural basis for its anion selectivity .

  • Calcium-binding domains: The conserved residues D25 and D181 in the CLCC1 N-terminus are responsible for Ca²⁺ binding and luminal Ca²⁺-mediated inhibition of channel open probability . These negatively charged aspartate residues likely form a calcium-binding pocket that induces conformational changes affecting the channel pore.

  • PIP2-interaction site: K298 in the CLCC1 intraluminal loop functions as the critical PIP2-sensing residue . This positively charged lysine residue likely interacts with the negatively charged phosphate groups of PIP2, facilitating channel opening through conformational changes.

  • Multimerization interfaces: CLCC1 forms homomultimers (~180 kD and ~360 kD complexes), with the 360 kD form being predominant for endogenous CLCC1 . These multimerization interfaces are essential for forming the functional channel pore.

Future structural studies, particularly cryo-electron microscopy of the multimeric complex, will be necessary to fully elucidate the three-dimensional arrangement of these functional domains and their dynamic interactions during channel gating.

What is the relationship between CLCC1 dysfunction and other ER-associated neurodegenerative diseases beyond ALS?

CLCC1 dysfunction may contribute to multiple ER-associated neurodegenerative diseases beyond ALS through common pathogenic mechanisms:

  • ER stress and the unfolded protein response: CLCC1 deficiency triggers ER stress and activates the UPR pathway . Chronic ER stress is implicated in various neurodegenerative conditions including Alzheimer's, Parkinson's, and Huntington's diseases. CLCC1 dysfunction may exacerbate protein misfolding in these disorders through disruption of the ER folding environment.

  • Selective neuronal vulnerability: Similar to the specific vulnerability of cerebellar granule cells and motor neurons to CLCC1 deficiency , other neuron populations show selective vulnerability in different neurodegenerative diseases. The varying expression levels or functional requirements for CLCC1 across neuronal subtypes may contribute to this selective vulnerability.

  • Protein aggregation: CLCC1-deficient neurons accumulate ubiquitinated proteins before their degeneration . This protein aggregation phenotype is a hallmark of numerous neurodegenerative diseases, suggesting CLCC1 may influence proteostasis more broadly.

  • Ion homeostasis disruption: Beyond chloride imbalance, CLCC1 dysfunction also affects calcium handling in the ER . Calcium dysregulation is a common feature across neurodegenerative diseases, potentially linking CLCC1 to these pathologies.

While direct evidence linking CLCC1 to neurodegenerative diseases beyond ALS is still emerging, the fundamental role of CLCC1 in ER proteostasis suggests it may be relevant to multiple disorders characterized by protein misfolding and ER dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.