Recombinant Human Chloride intracellular channel protein 2 (CLIC2)

Shipped with Ice Packs
In Stock

Description

Regulation of Calcium Signaling

CLIC2 modulates ryanodine receptor 2 (RyR2) activity by inhibiting calcium release from the sarcoplasmic reticulum . This interaction stabilizes RyR2 in a conformation that separates domains 9 and 10, mimicking the open state without transmembrane pore dilation . Dysregulation (e.g., H101Q mutation) causes X-linked intellectual disability and cardiomegaly by overactivating RyR2, leading to prolonged calcium release .

Modulation of Matrix Metalloproteinases (MMPs)

CLIC2 suppresses tumor invasion and metastasis by inhibiting MMP-14 and MMP-9 activities . Recombinant CLIC2 reduces glioblastoma cell invasion by 60–70% in Boyden chamber assays . Conversely, CLIC2 knockdown in microglia increases MMP-9 secretion, enhancing neuroinflammatory damage in Parkinson’s disease models .

Fusogenic Activity

Recent studies reveal CLIC2’s pH-dependent membrane fusion capability. Acidic pH triggers conformational changes in its hydrophobic inter-domain interface, enabling liposomal fusion—a mechanism critical for organelle dynamics .

Neurodegenerative Disease

  • Parkinson’s Disease: CLIC2 upregulation in 6-OHDA-induced PD models enhances microglial invasion via MMP-9 activation . Recombinant CLIC2 increases microglial metabolic activity by 40%, exacerbating neuroinflammation .

  • Therapeutic Target: siRNA-mediated CLIC2 knockdown reduces MMP-9 release by 65%, suggesting anti-inflammatory potential .

Cancer Biology

  • Tumor Suppression: Benign meningiomas express 3–5× higher CLIC2 levels than glioblastomas. High CLIC2 correlates with prolonged progression-free survival (p < 0.05) .

  • Mechanism: CLIC2 binds MMP-14 extracellularly, inhibiting MMP-2 activation and Matrigel degradation .

Applications in Biomedical Research

  • Invasion Assays: Used to study CLIC2’s anti-metastatic effects in glioblastoma (U251, SFC-2) and meningioma cell lines .

  • Calcium Imaging: Recombinant CLIC2 (1–10 µM) inhibits RyR2-mediated Ca²⁺ release in cardiac myocytes .

  • Liposomal Fusion Studies: CLIC5 (a paralog) induces lipid mixing at pH 6.0, a model for CLIC2’s fusogenic role .

Future Directions

  • Therapeutic Development: Engineered CLIC2 variants could target RyR2 or MMP-9 in cardiac/neurodegenerative diseases .

  • Structural Studies: Cryo-EM of CLIC2-RyR complexes may clarify allosteric inhibition mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CLIC2; Chloride intracellular channel protein 2; XAP121
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CLIC2
Target Protein Sequence
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEE LKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKF SAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLT LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA NVAKQKS
Uniprot No.

Target Background

Function
Recombinant Human Chloride intracellular channel protein 2 (CLIC2) inserts into membranes to form chloride ion channels. Channel activity is pH-dependent. Membrane insertion appears redox-regulated, potentially occurring only under oxidizing conditions. CLIC2 modulates RYR2 activity and inhibits calcium influx.
Gene References Into Functions
  1. Crystal structure determination of soluble Clic2 from Oreochromis mossambicus reveals high conservation among tilapia, human CLIC2, and other CLIC proteins. PMID: 29198705
  2. CLIC2 plays a crucial role in maintaining normal cognitive function through its interaction with RyRs in the brain. PMID: 22814392
  3. CLIC2 inhibits cardiac ryanodine receptor Ca2+ release channels in lipid bilayers (cytoplasmic side addition) and Ca2+ release from cardiac sarcoplasmic reticulum vesicles. PMID: 15147738
  4. CLIC2 forms pH-dependent chloride channels *in vitro*, exhibiting higher activity at lower pH and redox regulation. PMID: 17945253
  5. Human CLIC2 crystallized in two forms (with GSSH) exhibiting P212121 (Form A; a=44.0, b=74.7, c=79.8 Å) and P21 (Form B; a=36.0, b=66.9, c=44.1 Å) symmetry. PMID: 18007051
  6. Crystal structure of soluble human CLIC2 and functional implications. PMID: 18186468
Database Links

HGNC: 2063

OMIM: 300138

KEGG: hsa:1193

STRING: 9606.ENSP00000358460

UniGene: Hs.655445

Involvement In Disease
Mental retardation, X-linked, syndromic, 32 (MRXS32)
Protein Families
Chloride channel CLIC family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein. Note=Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain.
Tissue Specificity
Expressed in adult and fetal brain, heart, skeletal muscle, liver, lung, and spleen. Detected in adult stomach and testis. Expressed in fetal thymus and kidney.

Q&A

What is CLIC2 and what are its primary functions?

CLIC2 (Chloride Intracellular Channel 2) is a protein-coding gene located on the X chromosome. It encodes a chloride intracellular channel protein that belongs to a diverse group of proteins regulating fundamental cellular processes . CLIC2 can insert into membranes to form chloride ion channels, with this activity being pH-dependent . The protein plays crucial roles in several cellular functions, including:

  • Stabilization of cell membrane potential

  • Transepithelial transport regulation

  • Maintenance of intracellular pH homeostasis

  • Regulation of cell volume

  • Modulation of RYR2 (ryanodine receptor 2) activity

  • Inhibition of calcium influx

Membrane insertion of CLIC2 appears to be redox-regulated, potentially occurring primarily under oxidizing conditions . When considering experimental work with this protein, researchers should account for these redox conditions to maintain proper function.

What is the molecular structure of recombinant human CLIC2 protein?

Recombinant human CLIC2 protein typically consists of the amino acid sequence from Met1 to Ser247 . When produced for research applications, it is commonly expressed with a 6His tag at the N-terminus to facilitate purification and detection . The molecular mass of the native protein is approximately 30.5 kDa, while the apparent molecular mass under reducing conditions in SDS-PAGE is approximately 32 kDa .

The three-dimensional structure of CLIC2 has been predicted using computational methods such as AlphaFold (AF2), which provides structural insights in the absence of complete experimental structures . When working with recombinant CLIC2, researchers should be aware that the confidence score (pLDDT) provided by AF2 can be a useful indicator of structural reliability for different regions of the protein .

How is recombinant human CLIC2 protein typically produced for research applications?

Recombinant human CLIC2 protein for research applications is typically produced using E. coli expression systems . The standard methodology involves:

  • Gene cloning: The gene encoding Met1-Ser247 of human CLIC2 is cloned into an appropriate expression vector.

  • Tag addition: A 6His tag is commonly added at the N-terminus to facilitate purification.

  • Transformation: The construct is transformed into an E. coli expression strain.

  • Expression induction: Protein expression is induced under optimized conditions.

  • Purification: The protein is purified using affinity chromatography (leveraging the His-tag).

  • Quality control: Purity assessment is performed using reducing SDS-PAGE, with research-grade products typically exceeding 95% purity .

  • Formulation: The purified protein is typically formulated in a buffer containing 20mM Tris-HCl, 100mM NaCl, 1mM DTT, and 20% Glycerol at pH 8.0 .

For experimental applications requiring endotoxin-free preparations, additional processing steps are implemented to reduce endotoxin levels below 0.1 ng/μg (1 EU/μg) .

What methodologies are most effective for investigating CLIC2 channel activity and its pH dependence?

Investigating CLIC2 channel activity and its pH dependence requires specialized methodologies focused on membrane protein function. Effective approaches include:

  • Planar lipid bilayer electrophysiology: This technique allows direct measurement of channel conductance by incorporating purified CLIC2 into artificial lipid bilayers. The experimental setup should include:

    • Varying pH conditions (typically pH 5.5-7.5) to measure pH dependence

    • Precise control of redox conditions (oxidizing vs. reducing)

    • Measurement of single-channel conductance and open probability

  • Liposome-based flux assays: These assays measure chloride flux across liposomal membranes containing incorporated CLIC2:

    • Preparation of liposomes with defined lipid composition

    • Incorporation of purified CLIC2 protein

    • Using chloride-sensitive fluorescent dyes to measure transport rates

    • Testing pH dependence by preparing liposomes with different internal pH values

  • Patch-clamp electrophysiology: For cellular studies, whole-cell or excised patch recordings from cells overexpressing CLIC2 can be used:

    • Transfection of cells with CLIC2 expression constructs

    • Precise control of intracellular and extracellular pH

    • Measurement of chloride currents under varying conditions

These methods should be complemented with site-directed mutagenesis approaches targeting putative pH-sensing residues to establish structure-function relationships.

How does CLIC2 modulate ryanodine receptor 2 (RYR2) function, and what experimental approaches best characterize this interaction?

CLIC2 is known to modulate RYR2 activity and inhibit calcium influx, suggesting an important role in calcium homeostasis . To characterize this interaction effectively, researchers can employ:

  • Calcium imaging techniques:

    • Loading cells with calcium-sensitive fluorescent dyes (e.g., Fura-2, Fluo-4)

    • Co-expressing CLIC2 and RYR2 in heterologous expression systems

    • Measuring calcium transients in response to RYR2 activators with and without CLIC2

  • Co-immunoprecipitation and pull-down assays:

    • Using recombinant His-tagged CLIC2 for pull-down experiments

    • Immobilizing RYR2 fragments to identify specific binding domains

    • Performing reciprocal co-IP experiments in cells expressing both proteins

  • Surface plasmon resonance (SPR):

    • Immobilizing either CLIC2 or RYR2 fragments on sensor chips

    • Measuring binding kinetics and affinity constants

    • Determining the effect of pH and redox conditions on binding

  • Site-directed mutagenesis:

    • Creating point mutations in CLIC2 at putative interaction sites

    • Evaluating the effect of these mutations on RYR2 binding and function

    • Correlating findings with structural predictions from AlphaFold models

  • [Ca²⁺] single channel recordings:

    • Incorporating purified RYR2 into lipid bilayers

    • Adding recombinant CLIC2 and measuring changes in channel gating parameters

    • Testing concentration-dependence of CLIC2 inhibition

What is the relationship between CLIC2 mutations and intellectual disability disorders, and how can recombinant proteins be used to study these mutations?

CLIC2 mutations have been associated with X-linked intellectual disability disorders, including Intellectual Developmental Disorder, X-Linked, Syndromic 32 and X-Linked Intellectual Disability-Cardiomegaly-Congestive Heart Failure Syndrome . Recombinant proteins provide powerful tools for investigating these mutations:

  • Structure-function analysis:

    • Generate recombinant CLIC2 proteins containing disease-associated mutations

    • Compare channel activity, protein stability, and RYR2 modulation between wild-type and mutant proteins

    • Correlate functional changes with structural predictions from AlphaFold models

  • Protein stability assessment:

    • Use thermal shift assays to compare stability of wild-type and mutant CLIC2

    • Implement computational stability predictors (e.g., Maestro, mCSM, CUPSAT) using AlphaFold structures

    • Compare experimental results with computational predictions

  • Cellular models:

    • Express wild-type or mutant CLIC2 in neuronal cell lines

    • Assess effects on chloride homeostasis and calcium signaling

    • Measure impact on RYR2-dependent calcium release

  • Patient-derived cellular models:

    • Generate induced pluripotent stem cells (iPSCs) from patients with CLIC2 mutations

    • Differentiate iPSCs into neurons or cardiomyocytes

    • Rescue phenotypes using wild-type recombinant CLIC2 protein

What are optimal storage and handling conditions for maintaining recombinant CLIC2 stability and activity?

Maintaining the stability and activity of recombinant CLIC2 requires careful attention to storage and handling conditions:

  • Storage temperature: Store at ≤-70°C for long-term preservation of activity . Avoid repeated freeze-thaw cycles by preparing single-use aliquots.

  • Buffer composition: Optimal buffer conditions include:

    • 20mM Tris-HCl, pH 8.0

    • 100mM NaCl

    • 1mM DTT (critical for maintaining redox state)

    • 20% Glycerol (cryoprotectant)

  • Redox considerations: CLIC2 function is redox-sensitive, with membrane insertion occurring under oxidizing conditions . Therefore:

    • Maintain consistent redox conditions appropriate for experimental goals

    • Consider the impact of oxidizing agents on protein activity

    • For some experiments, removing DTT may be necessary to permit membrane insertion

  • Protein concentration: Protein concentration should be maintained at levels that prevent aggregation while ensuring sufficient activity.

  • pH considerations: Since CLIC2 activity is pH-dependent , storage buffers should maintain a consistent pH, and experimental buffers should be carefully controlled depending on the research question.

How can researchers effectively validate the structural integrity and functional activity of recombinant CLIC2 preparations?

Validating recombinant CLIC2 integrity and functionality requires multiple complementary approaches:

  • Structural integrity assessment:

    • SDS-PAGE analysis under reducing conditions to confirm expected molecular weight

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to confirm proper folding

  • Functional validation:

    • Chloride channel activity assays in liposomes or planar lipid bilayers

    • RYR2 modulation assays measuring calcium flux

    • pH-dependent activity profiling

    • Redox-dependent membrane insertion assays

  • Binding assays:

    • Interaction studies with known binding partners (e.g., RYR2)

    • Assessment of glutathione binding, relevant to its glutathione transferase homology

  • Computational validation:

    • Comparison of experimental data with predictions from AlphaFold models

    • Assessment of confidence scores (pLDDT) for regions of interest in the protein

What are the most reliable expression systems and purification strategies for producing high-quality recombinant CLIC2 for structural and functional studies?

Producing high-quality recombinant CLIC2 requires optimized expression and purification strategies:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliHigh yield, cost-effective, rapid productionLacks post-translational modifications, potential inclusion body formationStructural studies, in vitro functional assays
Insect cellsBetter folding, some post-translational modificationsMore expensive, lower yield than E. coliComplex functional studies requiring native-like protein
Mammalian cellsNative post-translational modifications, proper foldingHighest cost, lowest yieldStudies focusing on authentic post-translational modifications

Recommended purification strategy for E. coli-expressed CLIC2:

  • Lysis: Sonication or high-pressure homogenization in a buffer containing 50mM Tris-HCl pH 8.0, 300mM NaCl, 10mM imidazole, and protease inhibitors.

  • Primary purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, with:

    • Binding buffer: 50mM Tris-HCl pH 8.0, 300mM NaCl, 10mM imidazole

    • Washing buffer: 50mM Tris-HCl pH 8.0, 300mM NaCl, 20mM imidazole

    • Elution buffer: 50mM Tris-HCl pH 8.0, 300mM NaCl, 250mM imidazole

  • Secondary purification: Size exclusion chromatography using a Superdex 75 or 200 column in final buffer (20mM Tris-HCl, 100mM NaCl, 1mM DTT, pH 8.0).

  • Endotoxin removal: If required for cellular experiments, use endotoxin removal resins or phase separation techniques.

  • Quality control: Assess purity by SDS-PAGE (target >95%), verify identity by mass spectrometry, and confirm activity using functional assays.

How can AlphaFold (AF2) predictions be effectively utilized to study CLIC2 structure and predict the impact of mutations?

AlphaFold (AF2) provides valuable structural predictions for proteins like CLIC2, which can be effectively utilized in research:

  • Structure assessment and validation:

    • Evaluate the global confidence score for CLIC2 structural predictions

    • Focus analyses on regions with high predicted local difference distance test (pLDDT) scores

    • Compare AF2 predictions with any available experimental structural data

  • Mutation impact analysis:

    • Use AF2 structures as input for stability predictors like Maestro, mCSM, and CUPSAT

    • Assess the potential impact of disease-associated or experimental mutations

    • Consider both the stability change predictions and the confidence score of the region containing the mutation

  • Structure-function relationship studies:

    • Identify potential functional domains and interaction interfaces

    • Design targeted mutations for experimental validation

    • Guide the design of truncated constructs for domain-specific studies

  • Important considerations:

    • The pLDDT score itself can be a predictor of variant pathogenicity, with an AUROC of 0.852 reported in related studies

    • Regions with low confidence scores should be interpreted cautiously

    • Integrate computational predictions with experimental validation

What bioinformatic approaches can help identify potential interaction partners and functional domains of CLIC2?

Bioinformatic approaches offer powerful tools for identifying CLIC2 interaction partners and functional domains:

  • Sequence-based approaches:

    • Multiple sequence alignment to identify conserved residues across CLIC family proteins

    • Motif scanning for known functional domains and protein-protein interaction motifs

    • Analysis of paralogous relationships, particularly with CLIC6

  • Structure-based approaches:

    • Molecular docking simulations with potential binding partners, particularly RYR2

    • Identification of surface patches with high conservation or electrostatic complementarity

    • Cavity analysis to identify potential ligand binding sites or ion channels

  • Network-based approaches:

    • Protein-protein interaction database mining

    • Co-expression analysis across tissue types

    • Pathway enrichment analysis related to CLIC2 function

  • Integrative approaches:

    • Correlation of Gene Ontology annotations with structural features

    • Analysis of related pathways, including cAMP-dependent PKA activation and cardiac conduction

    • Integration of patient variant data with structural and functional predictions

What are the most promising applications of CLIC2 research in understanding and treating associated disorders?

Research on CLIC2 has significant potential for understanding and treating associated disorders, particularly X-linked intellectual disability disorders with cardiomegaly and congestive heart failure . Promising applications include:

  • Therapeutic development:

    • Design of small molecules that can modulate CLIC2 function

    • Development of recombinant CLIC2 variants as potential therapeutic agents

    • Gene therapy approaches for CLIC2-related disorders

  • Diagnostic advancements:

    • Development of functional assays to assess the pathogenicity of CLIC2 variants

    • Integration of structural predictions with clinical data to improve variant classification

    • Biomarker discovery for early detection of CLIC2-related disorders

  • Mechanistic insights:

    • Detailed understanding of the CLIC2-RYR2 interaction and its role in calcium homeostasis

    • Clarification of CLIC2's role in neuronal function and cardiac physiology

    • Exploration of potential roles in other cellular processes beyond established functions

  • Translational research:

    • Development of patient-derived cellular models for drug screening

    • Creation of animal models with human CLIC2 variants

    • Personalized medicine approaches based on specific CLIC2 mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.