Recombinant Human Chloride intracellular channel protein 5 (CLIC5)

Shipped with Ice Packs
In Stock

Description

Introduction

Chloride intracellular channel protein 5 (CLIC5) is a member of the CLIC family of proteins, which are known to function in various cellular processes, including membrane fusion and ion channel activity . CLIC5 is expressed in various tissues and has been implicated in myoblast differentiation, skeletal muscle regeneration, and hearing .

Basic Information

CLIC5 is a protein that belongs to the chloride intracellular channel (CLIC) family . The CLIC family members are known to have roles in cellular functions such as membrane fusion . A study indicates that CLIC5 interacts directly with membranes to facilitate their fusion .

Gene Information

The human CLIC5 gene, also known as chloride intracellular channel 5, is located on chromosome 6 . The mouse ortholog of this gene is also called Clic5 .

CLIC5 in Muscle Development

CLIC5 promotes myoblast differentiation by activating the canonical Wnt/β-catenin signaling pathway in a biglycan (BGN)-dependent manner . Research shows that loss of CLIC5 reduces muscle weight and decreases the number and differentiation potential of satellite cells .

  • Loss of CLIC5: Conditional knockout (KO) of CLIC5 in mice resulted in reduced body weight in both male and female mice starting at 3 weeks of age . At 9 weeks, male and female CLIC5 KO mice showed a 9.67% and 5.55% reduction in body weight, respectively . The tibialis anterior (TA) and gastrocnemius (GAS) muscles in adult CLIC5 KO mice were lighter than those of wild-type mice . The proportion of MuSCs was significantly decreased in the hind limbs of CLIC5 .

  • CLIC5 and Myoblast Differentiation: CLIC5 inhibits myoblast proliferation while promoting myogenic differentiation and myotube formation . CLIC5 is critical in maintaining a balance between myoblast proliferation and differentiation .

  • Wnt/β-catenin Signaling: CLIC5 mediates proliferation and myogenic differentiation through the canonical Wnt/β-catenin signaling pathway .

  • Interaction with BGN: CLIC5 interacts with BGN to enhance myoblast differentiation and the canonical Wnt/β-catenin signaling pathway . Residues 1 to 105 in CLIC5 are responsible for its binding to BGN, which is crucial for the insertion of CLIC5 into the plasma membrane .

CLIC5 and Hearing Impairment

A study identified bi-allelic novel variants in CLIC5 in a Cameroonian family with non-syndromic hearing impairment, which confirms CLIC5 as a novel gene associated with hearing loss . CLIC5 interacts with GRXCR2, and both proteins are localized at the stereociliary base in hair cells .

CLIC5-Mediated Membrane Fusion

  • Interaction with Liposomes: CLIC5 interacts directly with liposomes, as demonstrated by co-floatation assays and FRET measurements .

  • Increase in Liposome Diameter: Incubation of liposomes with CLIC5 results in an increase in particle diameter, suggesting that liposomes undergo aggregation or fusion .

  • Fusion Activity: CLIC5 exhibits the ability to facilitate membrane fusion .

Tables of Data

The following data were generated from studies on mice.

GeneTissueExpression LevelP Value
CLIC5Tibialis anterior (TA)Reduced< 0.05
CLIC5Extensor digitorum longusReduced< 0.05
CLIC5Gastrocnemius (GAS)Reduced< 0.05
CLIC3Tibialis anterior (TA) of CLIC5 MKOmiceDecreasedN/A

\
\
The following table shows the effect of CLIC5 regulation on muscle stem cell function.

MeasurementResult
Body weight in male mice9.67% reduction
Body weight in female mice5.55% reduction
TA and GAS muscles in adult CLIC5Lighter than wild-type
MuSCs proportion in hind limbsSignificantly decreased

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CLIC5; Chloride intracellular channel protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CLIC5
Target Protein Sequence
MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVS VYTIKGEETSLASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLC AAELQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVK AGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDV KTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGL TKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKK YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Uniprot No.

Target Background

Function

CLIC5 is essential for normal hearing, playing a critical role in stereocilia formation in the inner ear and the proper development of the organ of Corti. It inserts into cell membranes, forming ion channels with low selectivity, potentially transporting chloride ions. CLIC5 may regulate transepithelial ion absorption and secretion. Furthermore, it is required for the development and maintenance of glomerular endothelial cell and podocyte architecture, and contributes to the formation of lens sutures in the eye, crucial for maintaining the lens's optical properties.

Gene References Into Functions
  1. ETV6 loss leads to significant CLIC5 overexpression, decreasing lysosome-mediated apoptosis, potentially promoting oxidative stress-induced DNA damage and leukemogenesis. PMID: 27540136
  2. EZR, CLIC5, and PODXL overexpression in hepatocellular carcinoma may contribute to cell migration and invasiveness. PMID: 26135398
  3. CLIC5A's mechanism involves clustered plasma membrane phosphatidylinositol 4,5-bisphosphate accumulation, activating ezrin and facilitating actin-dependent cell surface remodeling. PMID: 25344252
  4. CLIC5 is implicated in progressive hearing impairment, vestibular dysfunction, and possibly mild renal dysfunction. PMID: 24781754
  5. CLIC5A colocalizes with ezrin and podocalyxin in podocytes, playing a role in maintaining glomerular endothelial cell and podocyte architecture. PMID: 20335315
  6. Association with Golgi apparatus AKAP350. PMID: 12163479
  7. CLIC-5A functions as a chloride channel in vitro and binds to the cortical actin cytoskeleton. PMID: 15184393
  8. CLIC5 is found in cultured lymphoblasts. PMID: 17492382
  9. CLIC1 and CLIC5, but not CLIC4, are strongly and reversibly inhibited by F-actin. PMID: 18028448
Database Links

HGNC: 13517

OMIM: 607293

KEGG: hsa:53405

STRING: 9606.ENSP00000185206

UniGene: Hs.485489

Involvement In Disease
Deafness, autosomal recessive, 103 (DFNB103)
Protein Families
Chloride channel CLIC family
Subcellular Location
[Isoform 1]: Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Membrane; Single-pass membrane protein. Apical cell membrane; Single-pass membrane protein. Cytoplasm.; [Isoform 2]: Golgi apparatus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Tissue Specificity
Widely expressed in both fetal and adult human tissues. Isoform 1 is expressed in renal glomeruli endothelial cells and podocytes (at protein level).

Q&A

What is Chloride Intracellular Channel Protein 5 (CLIC5) and what are its primary functions?

CLIC5 belongs to the Chloride Intracellular Channel protein family and uniquely transitions between soluble and membrane-associated forms. In its soluble state, CLIC5 catalyzes glutaredoxin-like thiol disulfide exchange reactions using reduced glutathione as an electron donor . Upon membrane association, it can insert into membranes to form non-selective ion channels with similar permeability to Na+, K+, and Cl- ions .

Recent research has revealed that CLIC5 also functions as a fusogen, directly interacting with membranes and facilitating fusion between lipid bilayers . This activity is reflected by increased liposomal diameter and lipid mixing between liposomes when exposed to purified CLIC5 .

CLIC5's physiological functions include:

  • Formation of stereocilia in the inner ear and development of the organ of Corti (essential for hearing)

  • Maintenance of glomerular endothelial cell and podocyte architecture in kidneys

  • Regulation of transepithelial ion absorption and secretion

  • Formation of lens suture in the eye (important for optical properties)

  • Promotion of myoblast differentiation and skeletal muscle development

How does CLIC5 contribute to hearing function and what evidence links it to deafness?

CLIC5 plays a critical role in normal hearing by contributing to the formation and maintenance of stereocilia in hair cells of the inner ear . These stereocilia are the sensory "hairs" that detect sound vibrations and convert them into electrical signals for the brain to interpret.

Evidence linking CLIC5 to hearing function includes:

  • Mutations in the CLIC5 gene lead to deafness in humans

  • A spontaneous mutation in mouse CLIC5 results in congenital progressive hearing impairment, vestibular dysfunction, and progressive loss of stereocilia

  • CLIC5 is necessary for the normal development of the organ of Corti

  • CLIC5 interacts with another protein called taperin, which has also been linked to hearing loss

Research indicates that CLIC5's role in hearing likely involves its membrane-remodeling capabilities. When this function is disrupted, it leads to aberrant and mis-coordinated membrane remodeling that affects stereocilia integrity and ultimately causes hearing loss .

What experimental methods are commonly used to study recombinant CLIC5 protein?

Several methodological approaches are employed to study recombinant CLIC5:

  • Protein Expression Systems:

    • Wheat germ expression systems for producing recombinant human CLIC5 protein fragments (e.g., amino acids 91-190)

    • Bacterial expression systems for full-length protein production

  • Protein-Membrane Interaction Assays:

    • Liposome co-floatation assays to separate soluble and liposome-bound proteins

    • FRET assays between CLIC5 tryptophan residues (donors) and dansyl-PE-containing liposomes (acceptors) to measure direct interaction with lipid bilayers

    • Dynamic light scattering (DLS) to measure changes in particle size following CLIC5-membrane interactions

  • Membrane Fusion Detection Methods:

    • R18-based lipid mixing assays that utilize self-quenching properties of the dye to detect membrane fusion events

    • Content mixing assays using fluorescent markers to confirm complete fusion rather than just aggregation

  • Analytical Techniques:

    • ELISA and Western blotting (WB) for protein detection and quantification

    • X-ray crystallography and mass spectrometry for structural analysis

How does CLIC5 function as a membrane fusogen and what experimental evidence supports this role?

Recent research has demonstrated that CLIC5 functions as a fusogen - a protein capable of facilitating membrane fusion events. The experimental evidence supporting this novel function includes:

  • Direct Membrane Interaction:

    • Liposome co-floatation assays show CLIC5 associating with the membrane fraction, similar to known membrane-binding proteins like calcium-bound DOC2B

    • FRET measurements between CLIC5 tryptophan residues and dansyl-PE-containing liposomes confirm direct interaction with lipid bilayers

  • Fusion Activity Measurements:

    • Dynamic light scattering (DLS) analysis reveals a significant increase in particle diameter when liposomes are incubated with CLIC5, indicating membrane fusion or aggregation

    • R18-based lipid mixing assays demonstrate that CLIC5 induces mixing of membrane lipids between separate liposomes, confirming actual fusion rather than mere aggregation

    • Content mixing assays further validate complete fusion of liposomal compartments

  • Structural Requirements:

    • Mutagenesis studies establish that the inter-domain interface of CLIC5 is crucial for its fusion activity

    • X-ray crystallography demonstrates that CLIC5's inherent flexibility enables conformational transitions necessary for membrane interaction and fusion

  • Environmental Factors:

    • Acidic pH facilitates CLIC5's fusion activity, correlating with conditions that trigger its transition to a membrane-associated conformation

    • Increased exposure of hydrophobic regions during conformational changes appears critical for the fusion process

These findings suggest that CLIC5's fusogenic activity may underlie its various physiological functions, including its roles in stereocilia formation and membrane remodeling.

What role does CLIC5 play in skeletal muscle development and how can researchers study this function?

Recent research indicates CLIC5 promotes myoblast differentiation and skeletal muscle development . Experimental approaches to study this function include:

  • Knockdown Studies:

    • CLIC5 knockdown experiments in C2C12 myoblasts demonstrate its importance in myogenic differentiation

    • Conditional knockout mouse models (CLIC5^MKO) provide in vivo evidence of CLIC5's role in muscle development, with knockout mice showing reduced body weight from 3 weeks of age in both males and females

  • Expression Analysis:

    • Comparing mRNA expression levels of CLIC5 and other CLIC family members in various muscle tissues (TA, GAS, extensor digitorum longus) between wild-type and knockout models

    • Analysis of compensatory expression of other CLIC family members (e.g., CLIC3) in response to CLIC5 deletion

  • Phenotypic Assessment:

    • Body weight measurements at different developmental timepoints to assess growth impact

    • Tissue-specific analyses of muscle development and function

This research direction reveals CLIC5's previously uncharacterized importance in muscle biology, expanding our understanding beyond its established roles in hearing and kidney function.

How do pH conditions affect CLIC5's conformational changes and functional activities?

The conformational transitions and functional activities of CLIC5 are significantly influenced by pH conditions:

  • Membrane Fusion Activity:

    • Acidic pH facilitates CLIC5's fusogenic activity, serving as a trigger for its transition from soluble to membrane-associated conformations

    • Under acidic conditions, CLIC5 undergoes structural changes that increase exposure of its hydrophobic inter-domain interface, which is crucial for membrane interaction and fusion

  • Experimental Assessment Methods:

    • Researchers can investigate pH-dependent activities by conducting membrane fusion assays across different pH gradients (typically pH 4.5-7.5)

    • Structural studies using circular dichroism spectroscopy or intrinsic fluorescence can monitor conformational changes induced by varying pH

    • Liposome-based assays performed under controlled pH conditions can quantify the relationship between pH and fusogenic activity

  • Physiological Relevance:

    • The pH sensitivity suggests CLIC5 may have specialized functions in cellular compartments with acidic microenvironments

    • This property may explain tissue-specific activities of CLIC5 in regions with distinct pH profiles

This pH dependency parallels mechanisms observed in viral fusogens and may represent an important regulatory mechanism for CLIC5's diverse cellular functions.

What approaches can researchers use to study the interaction between CLIC5 and taperin in hearing function?

The interaction between CLIC5 and taperin is critical for understanding hearing mechanisms, as mutations in both proteins have been linked to deafness . Researchers can employ several approaches to study this interaction:

  • Protein-Protein Interaction Assays:

    • Co-immunoprecipitation (Co-IP) to confirm direct interaction between CLIC5 and taperin in relevant cell types

    • Proximity ligation assays (PLA) to visualize interactions in situ within hair cells

    • FRET or BRET methods to measure interaction dynamics in living cells

  • Structural Characterization:

    • Mapping interaction domains through truncation and site-directed mutagenesis

    • X-ray crystallography or cryo-EM to determine the structure of the CLIC5-taperin complex

    • Computational modeling to predict interaction interfaces and functional consequences

  • Functional Studies:

    • Dual knockdown/knockout models to assess synergistic effects on hearing function

    • Rescue experiments to determine if one protein can compensate for the loss of the other

    • Investigation of how this interaction affects stereocilia development using hair cell culture models

  • Hair Cell-Specific Approaches:

    • Immunofluorescence microscopy to determine co-localization patterns in hair cell stereocilia

    • Live-cell imaging to track the dynamics of both proteins during stereocilia development

    • Electrophysiological recordings to assess functional consequences of disrupting the interaction

Understanding this interaction could provide deeper insights into the molecular mechanisms of hearing and potentially inform therapeutic strategies for hearing loss related to mutations in either protein.

How can researchers effectively distinguish between CLIC5's ion channel activity and its membrane fusion function?

Distinguishing between CLIC5's ion channel and fusion functions requires specialized methodologies:

FunctionExperimental ApproachMeasurement ParametersControls
Ion Channel ActivityPatch-clamp electrophysiologyIonic current, conductance, selectivityChannel blockers, CLIC5 mutants
Planar lipid bilayer recordingsSingle channel propertiesOther ion channels, non-channel forming proteins
Fluorescent ion indicatorsIon flux kineticsIon gradients, specific inhibitors
Membrane FusionLipid mixing assays (R18-based)Fluorescence dequenchingDOC2B (positive), 14-3-3 (negative)
Content mixing assaysTransfer of luminal markersDOC2B+Ca²⁺ (positive)
Dynamic light scatteringParticle size increaseLiposome-only baseline

For definitive distinction:

  • Sequential functional analysis: Measure both activities in the same experimental setup with temporal resolution

  • Domain-specific mutations: Target regions predicted to affect one function but not the other

  • Environmental manipulation: Test both functions under conditions where one is expected to be favored (e.g., specific pH or lipid compositions)

  • Correlation studies: Assess whether conditions that enhance one function necessarily affect the other

  • Competition assays: Determine if known fusion proteins can compete with CLIC5's channel function and vice versa

These approaches provide a methodological framework for dissecting CLIC5's dual functionality and understanding how these distinct activities contribute to its physiological roles .

What are the current challenges and future directions in CLIC5 research?

Current challenges and future directions in CLIC5 research span multiple dimensions:

  • Mechanistic Understanding:

    • Resolving the precise mechanism by which CLIC5 transitions between soluble and membrane-associated states

    • Determining whether ion channel activity and membrane fusion functions are independent or interdependent

    • Identifying the complete set of CLIC5 binding partners and how they regulate its various functions

  • Physiological Relevance:

    • Clarifying the relative contribution of CLIC5's fusion activity versus ion channel properties in different tissues

    • Understanding tissue-specific regulation of CLIC5 expression and activity

    • Determining how CLIC5 dysfunction leads to specific pathologies in hearing, vision, and muscle development

  • Therapeutic Applications:

    • Developing approaches to modulate CLIC5 activity for potential therapeutic benefit in hearing loss

    • Exploring CLIC5's role in other disease contexts where membrane remodeling is important

    • Identifying small molecules that can selectively target CLIC5's different functions

  • Technical Challenges:

    • Creating better models to study CLIC5's conformational dynamics at membrane interfaces

    • Developing high-throughput assays to screen for modulators of CLIC5 activity

    • Improving methods to visualize CLIC5-mediated membrane fusion events in living cells

  • Integration with Other Research Fields:

    • Connecting CLIC5 research with broader understanding of membrane dynamics and remodeling

    • Exploring evolutionary relationships between CLIC proteins and other membrane-active proteins

    • Investigating potential roles in previously unexplored biological contexts based on its fusion activity

Future research will likely focus on leveraging CLIC5's newly discovered fusogenic properties to better understand its roles in development and disease, particularly in stereocilia formation, muscle differentiation, and potential applications in membrane biology .

How can researchers optimize recombinant CLIC5 production for structural and functional studies?

Optimizing recombinant CLIC5 production requires careful consideration of expression systems, purification strategies, and quality control:

  • Expression System Selection:

    • Wheat germ cell-free systems have been successfully used for producing recombinant human CLIC5 fragments (amino acids 91-190)

    • E. coli systems can be employed for full-length protein but require optimization to prevent inclusion body formation

    • Mammalian expression systems may better preserve post-translational modifications relevant to CLIC5 function

    • Insect cell systems offer a compromise between bacterial yield and mammalian folding capabilities

  • Construct Design Considerations:

    • Include appropriate purification tags (His, GST, etc.) that minimally impact protein function

    • Consider domain boundaries carefully when expressing fragments

    • For membrane interaction studies, avoid tags that might interfere with hydrophobic regions

    • Create specific mutants targeting the inter-domain interface to study structure-function relationships

  • Purification Strategy:

    • Implement multi-step purification including affinity chromatography, ion exchange, and size exclusion

    • Monitor protein oxidation state throughout purification, as this may affect conformational properties

    • Consider detergent selection carefully when working with membrane-associated forms

    • Validate proper folding using circular dichroism or intrinsic fluorescence spectroscopy

  • Quality Control Metrics:

    • Assess purity by SDS-PAGE and mass spectrometry

    • Confirm activity using established functional assays (e.g., glutaredoxin activity, membrane binding)

    • Verify homogeneity through dynamic light scattering

    • Evaluate stability under various storage conditions

  • Specific Functional Considerations:

    • For fusogenic activity studies, ensure protein samples are tested for lipid contamination

    • When studying pH-dependent transitions, verify protein stability across the relevant pH range

    • For structural studies, optimize buffer conditions to minimize conformational heterogeneity

These methodological considerations are essential for producing high-quality recombinant CLIC5 suitable for detailed structural and functional characterization .

What methodologies are most effective for studying CLIC5 knockout phenotypes in various tissue contexts?

Researchers investigating CLIC5 knockout phenotypes can employ several complementary methodologies:

  • Animal Model Generation:

    • Conditional knockout approaches (e.g., CLIC5^MKO for muscle-specific deletion) allow tissue-specific investigation while avoiding potential embryonic lethality

    • CRISPR/Cas9-mediated genome editing permits precise modification of the CLIC5 gene

    • Consider generating models with fluorescent protein tags to track expression patterns

  • Phenotypic Analysis in Hearing Research:

    • Auditory brainstem response (ABR) testing to quantify hearing thresholds

    • Scanning electron microscopy to examine stereocilia morphology

    • Vestibular testing to assess balance function related to inner ear development

    • Immunohistochemistry to evaluate hair cell development and taperin localization

  • Kidney Function Assessment:

    • Ultrastructural analysis of glomerular endothelial cells and podocytes

    • Proteinuria measurement to detect filtration barrier defects

    • Electron microscopy to examine membrane architecture

  • Muscle Development Analysis:

    • Body weight monitoring at different developmental timepoints

    • Histological assessment of muscle fiber development

    • Expression analysis of myogenic markers

    • Functional testing of muscle strength and endurance

  • Molecular Compensation Evaluation:

    • Expression analysis of other CLIC family members to detect potential compensatory upregulation

    • Proteomic profiling to identify broader adaptive responses to CLIC5 deletion

    • Double or triple knockout approaches to address functional redundancy

  • Cell-Based Models:

    • CLIC5 knockdown in relevant cell lines (e.g., C2C12 myoblasts) to study cell-autonomous effects

    • Rescue experiments with wild-type or mutant CLIC5 to confirm specificity

    • Live-cell imaging to track membrane dynamics in the absence of CLIC5

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.