Recombinant Human Chloride intracellular channel protein 6 (CLIC6)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Chloride Intracellular Channel Protein 6 (CLIC6)

Chloride Intracellular Channel 6 (CLIC6) is a member of the chloride intracellular channels (CLICs) family of proteins . CLIC proteins can exist in both soluble and transmembrane forms . CLIC6 is implicated in various cancers, including breast, ovarian, lung, gastric, and pancreatic cancers, and interacts with dopamine receptors .

Gene Information

The human CLIC6 gene, updated on January 4, 2025, is identified by Gene ID: 54102 .

Functional Studies

In a whole-cell configuration, CLIC6 currents were inhibited by IAA-94, a CLIC-specific blocker . CLIC6 activity is also regulated by pH and redox potential, with specific residues, such as histidine at position 648 (H648) in the C terminus and cysteine at position 487 (C487) in the N terminus, playing roles in pH-induced conformational changes and redox regulation, respectively .

Tissue Distribution

Quantitative real-time PCR (qRT-PCR) analysis has shown that CLIC6 is most abundant in the lung and brain tissues . Consistent with this finding, CLIC6 current has been recorded in mouse lung epithelial cells .

Ion Channel Properties

CLIC6 functions as a chloride channel, facilitating chloride transport across cell membranes . It shows enhanced activity at positive holding potentials . Experiments using HEK-293 cells transfected with CLIC6, examined via an automated patch-clamp approach, confirmed CLIC6's function as an anion channel sensitive to pH and redox regulation .

Role in Cancer and Other Diseases

CLIC6 is implicated in several types of cancer and interacts with dopamine receptors . Studies suggest its potential involvement in cancer pathogenesis and the tumor microenvironment, making it a possible therapeutic target .

Comparison with Other CLIC Members

CLIC6 shares structural similarities with other CLIC family members but also exhibits unique properties . Expression levels of CLIC family members vary in tumor versus normal tissues, with CLIC1 and CLIC3 associated with advanced cancer stages in hepatocellular carcinoma .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
CLIC6; CLIC1L; Chloride intracellular channel protein 6; Parchorin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-704
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CLIC6
Target Protein Sequence
MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEA GGGGPDRGPEAEARGTRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGE PRGEAQREPEDSAAPERQEEAEQRPEVPEGSASGEAGDSVDAEGPLGDNIEAEGPAGDSV EAEGRVGDSVDAEGPAGDSVDAEGPLGDNIQAEGPAGDSVDAEGRVGDSVDAEGPAGDSV DAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSMDAEGPAGRARRVSGEPQQSG DGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDARADAGEDRVG DGPQQEPGEDEERRERSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEE GPAEGSGEAARVNGRREDGEASEPRALGQEHDITLFVKVKLTALGCSRIAIKKYLRAGYD GESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDV NKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKAL RKLDNYLNSPLPDEIDAYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDF EFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK
Uniprot No.

Target Background

Function
CLIC6 inserts into cell membranes to form chloride ion channels. It plays a crucial role in water-secreting cells, likely through the regulation of chloride ion transport.
Database Links

HGNC: 2065

OMIM: 615321

KEGG: hsa:54102

STRING: 9606.ENSP00000290332

UniGene: Hs.473695

Protein Families
Chloride channel CLIC family
Subcellular Location
Cytoplasm. Cell membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in brain, placenta, pancreas and liver.

Q&A

What is the structural organization of recombinant human CLIC6?

Recombinant human CLIC6 belongs to the family of chloride intracellular channels that exist in dual forms: soluble cytosolic and membrane-associated. Crystallographic studies have revealed that CLIC6 adopts a monomeric arrangement in its soluble form, displaying significant structural conservation with other CLIC family members . The protein exhibits a globular architecture reminiscent of the omega-class glutathione S-transferases (GST-Ωs), though unlike GSTs, CLICs do not demonstrate non-covalent association with glutathione .

What is the tissue distribution pattern of CLIC6?

Quantitative RT-PCR analyses have established that CLIC6 demonstrates tissue-specific expression patterns. The protein is most abundantly expressed in:

TissueRelative Expression Level
LungHigh
BrainHigh
Other organsLower

This differential tissue distribution suggests specialized physiological roles in these organs . Researchers have successfully recorded CLIC6 currents in mouse lung epithelial cells, confirming its functional expression in lung tissue . The high expression in brain tissue correlates with observations that CLIC6 interacts with dopamine D2-like receptors, suggesting potential neurophysiological functions .

How can researchers effectively express recombinant CLIC6 for experimental studies?

For successful expression of functional recombinant CLIC6:

  • HEK-293 cells represent an established expression system for CLIC6 studies . Transfection of these cells results in localization of CLIC6 to the plasma membrane, facilitating electrophysiological characterization.

  • CLIC6 can be tagged with epitopes such as FLAG for immunodetection. Immunofluorescence studies using anti-FLAG antibodies and wheat germ agglutinin have confirmed plasma membrane localization upon ectopic expression .

  • Co-expression with GFP markers can facilitate identification of successfully transfected cells for patch-clamp studies .

  • For expression in different cell systems, it's important to note that CLIC6 localization patterns may vary. Previous studies in CHO and LLC-PK1 cells also demonstrated plasma membrane localization upon ectopic expression .

What electrophysiological approaches are most effective for characterizing CLIC6 channel properties?

Multiple complementary electrophysiological techniques have proven effective for comprehensive characterization of CLIC6:

  • Whole-cell patch-clamp recordings: This approach reveals macroscopic currents and allows determination of voltage-dependence, pharmacological sensitivity, and ion selectivity. Using step protocols from -100 to +100 mV followed by tail current analysis at -40 mV provides robust characterization of voltage-dependent properties .

  • Cell-attached single-channel recordings: This configuration allows detection of single-channel activity and determination of conductance states. With chloride compositions of 130 mM for the pipette and 4.2 mM for the cytoplasm, researchers have identified multiple conductance states including a main state and at least two distinct substates .

  • Automated patch-clamp platforms: The SyncroPatch 384i system has been successfully employed for high-throughput CLIC6 characterization. This approach enables multiple independent measurements with real-time monitoring of seal resistance, capacitance, and series resistance for each experiment .

  • Ion substitution experiments: Replacing chloride with other anions (bromide, fluoride) or cations (potassium) in recording solutions enables determination of ion selectivity profiles .

What is the ion selectivity profile of CLIC6 and how does it differ from other CLIC family members?

CLIC6 demonstrates a distinctive ion selectivity profile that differentiates it from other CLIC family members:

IonRelative Permeability
Cl⁻High
Br⁻Low
F⁻Low
K⁺Very low

The selectivity sequence follows: Cl⁻ >> Br⁻ = F⁻ >> K⁺ . This high selectivity for chloride ions is unique to CLIC6, as other CLIC members typically form poorly selective ion channels .

Researchers can determine ion selectivity by measuring currents in NMDG-Cl solution and then substituting with NMDG-Br, NMDG-F, KCl, or potassium methyl sulfate (KMeSO₄). The reversal potential for chloride is typically around -40 mV, shifting to approximately -60 mV when chloride is replaced with bromide or fluoride .

How do pH changes affect CLIC6 function and what are the molecular mechanisms involved?

CLIC6 channel activity demonstrates pH sensitivity, though with distinct characteristics:

  • Changing pH from 7.2 to 6.2 causes a slight but not significant decrease in CLIC6 current density .

  • The histidine residue at position 648 (H648) in the C-terminus plays a critical role in pH-dependent conformational changes. Mutation of H648 to alanine (H648A) results in significant reduction of current density and eliminates pH sensitivity between 7.2 and 6.2 .

  • Interestingly, the CLIC-specific blocker IAA-94 (10 μM) effectively blocks CLIC6 currents at pH 7.2 but shows reduced efficacy at pH 6.2. This pH-dependent pharmacological profile is abolished in the H648A mutant .

This pH regulation mechanism aligns with findings for other CLIC proteins. In CLIC1, two histidine residues are involved in pH-dependent conformational stability through their protonation. In CLIC6, H648 aligns with histidine 185 of CLIC1, suggesting conservation of this regulatory mechanism across the family .

How does redox potential influence CLIC6 function?

CLIC6 demonstrates significant redox sensitivity with specific molecular mechanisms:

  • Application of the reducing agent dithiothreitol (DTT) rapidly decreases CLIC6 channel activity, with effects observable within 100 milliseconds .

  • Cysteine residue 487 (C487) in the N-terminus serves as the primary redox sensor, aligning with cysteine 24 in CLIC1, which is established as the major target for redox regulation in that protein .

  • Mutation of C487 to alanine (C487A) significantly reduces CLIC6 activity and abolishes DTT sensitivity .

  • Under oxidative conditions, CLIC6 exhibits increased hydrophobicity alongside mild oligomerization. This effect is enhanced in the presence of membrane mimetics, providing insight into the potential mechanism for membrane insertion .

The redox regulation of CLIC6 is particularly significant as it likely represents a key mechanism controlling the transition between soluble and membrane-bound forms, a hallmark characteristic of the CLIC family.

How can researchers investigate the transition of CLIC6 between soluble and membrane-associated forms?

Investigating CLIC6's metamorphic transition requires multiple complementary approaches:

  • Structure-guided mutagenesis: Perturbation of the inter-domain interface through targeted mutations can induce population shifts toward elongated conformations of CLIC6, providing insight into structural dynamics preceding membrane insertion .

  • Hydrophobicity assays: Under oxidative conditions, CLIC6 demonstrates increased hydrophobicity, which can be measured as an indicator of conformational changes associated with membrane insertion potential .

  • Oligomerization analysis: Following oxidative treatment, CLIC6 exhibits mild oligomerization, which is enhanced in the presence of membrane mimetics. This suggests that multimerization may be a prerequisite for channel formation .

  • SAXS analysis with ensemble optimization: This approach has revealed that CLIC6 exists in multiple conformational states in solution, with a significant population adopting elongated forms. This structural plasticity is likely critical for its ability to transition between soluble and membrane-bound states .

  • Functional assays in artificial membranes: Though not reported specifically for CLIC6 in the available literature, planar bilayer systems have been used to study insertion mechanisms of other CLIC proteins and could be adapted for CLIC6 studies .

What pharmacological tools are available for studying CLIC6?

The pharmacological toolkit for CLIC6 remains limited but includes:

  • IAA-94 (indanyloxyacetic acid-94): A CLIC-specific blocker that inhibits CLIC6 currents at 10 μM concentration. In whole-cell configuration, IAA-94 blocks approximately 48 ± 5% of peak current at +100 mV, with significant block observed primarily at positive holding potentials . In single-channel recordings, 10 μM IAA-94 decreases channel open probability (Po) by 53 ± 4% at +100 mV and 51 ± 5% at -100 mV .

  • Redox modulators: DTT can be used as a functional modulator, rapidly decreasing CLIC6 activity .

  • pH modification: Buffer systems allowing precise control of pH can be used to study the pH-dependent properties of CLIC6 .

The development of more specific pharmacological tools for CLIC6 represents an important area for future research, as current options lack selectivity between CLIC family members.

What are the biophysical fingerprints that distinguish CLIC6 from other ion channels?

CLIC6 exhibits several distinctive biophysical properties that serve as its experimental fingerprint:

  • Voltage dependence: CLIC6 demonstrates voltage-dependent gating with a V₁/₂ of approximately 14.062 mV. The channel exhibits fast gating that closes at negative membrane voltages and opens upon depolarization to positive voltages .

  • Rectification profile: CLIC6 shows enhanced activity at positive holding potentials compared to negative potentials, with substantial rectification in the current-voltage relationship .

  • Conductance: Single-channel recordings reveal a conductance of approximately 3 pS, with multiple conductance states including a main open state and at least two distinct substates (including one at approximately 50% of the main opening) .

  • Pharmacological sensitivity: Sensitivity to IAA-94 with the distinctive feature that block occurs primarily at positive potentials in whole-cell configuration .

  • High chloride selectivity: Unlike other CLIC family members which form poorly selective channels, CLIC6 demonstrates high selectivity for chloride over other ions .

What is the evidence linking CLIC6 to cancer pathophysiology?

CLIC6 has been implicated in multiple cancer types, though precise mechanisms remain under investigation:

  • Studies have associated CLIC6 with breast, ovarian, lung, gastric, and pancreatic cancers .

  • The protein's ability to transition between soluble and membrane-bound forms may contribute to altered cellular signaling pathways in cancer progression .

  • The high expression of CLIC6 in lung tissue correlates with its implication in lung cancer, suggesting potential tissue-specific oncogenic mechanisms .

Further research is needed to clarify whether CLIC6 alterations are causative factors or consequences of oncogenic transformation, and whether pharmacological targeting of this channel might represent a therapeutic approach.

How does CLIC6 interact with dopamine receptors and what are the functional implications?

CLIC6 has been established to interact with dopamine D₂-like receptors, though functional consequences remain incompletely characterized:

  • Co-transfection studies with dopamine D₃-receptors in CHO cell lines failed to demonstrate CLIC6-mediated chloride fluxes, raising questions about the functional significance of this interaction .

  • The high expression of CLIC6 in brain tissue supports potential neurophysiological roles related to dopaminergic signaling .

  • The regulatory mechanisms identified for CLIC6 (pH and redox sensitivity) may link dopaminergic signaling to cellular redox states and local pH changes .

Additional research is needed to determine whether CLIC6-dopamine receptor interactions modulate receptor trafficking, signaling efficiency, or ion channel function in specific cellular contexts.

What are the current technical challenges in studying the membrane structure of CLIC6?

Despite significant progress in characterizing CLIC6, several technical challenges remain:

  • While the soluble structure has been resolved, the membrane-inserted form remains structurally uncharacterized .

  • The transient nature of the membrane-insertion process and potential conformational heterogeneity complicate structural studies .

  • The requirement for specific lipid environments and redox conditions to promote membrane insertion presents experimental complexity .

  • Potential oligomerization during membrane insertion introduces additional structural variables .

Future approaches combining cryo-electron microscopy, membrane protein crystallography, and computational modeling may overcome these challenges to reveal the membrane-integrated structure of CLIC6.

How can researchers distinguish between endogenous and recombinant CLIC6 in experimental systems?

Distinguishing endogenous from recombinant CLIC6 requires careful experimental design:

  • Epitope tagging: Fusion of epitope tags (such as FLAG) to recombinant CLIC6 enables specific detection using tag-directed antibodies .

  • Electrophysiological fingerprinting: Comparison of IAA-94-sensitive currents between transfected and non-transfected cells. Non-transfected HEK-293 cells exhibit chloride currents that are not blocked by IAA-94, whereas CLIC6-transfected cells show IAA-94 sensitivity .

  • Mutant expression: Introduction of function-altering mutations (such as H648A or C487A) can provide clear experimental distinction from wild-type endogenous channels .

  • Expression level quantification: qRT-PCR can quantify expression levels, with recombinant systems typically showing substantially higher expression than endogenous CLIC6 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.