Recombinant Human Cholecystokinin receptor type A (CCKAR)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Signaling Pathways

CCKAR mediates diverse physiological processes through G protein promiscuity:

G ProteinDownstream EffectBiological Role
GqPhospholipase C activationPancreatic enzyme secretion, gut motility
GscAMP productionAppetite regulation, dopamine release
GiInhibition of adenylyl cyclaseModulation of cardiac pacemaker activity

Key physiological functions:

  • Digestive system: Stimulates gallbladder contraction and gastric emptying .

  • Central nervous system: Regulates satiety and β-endorphin release .

  • Cardiac regulation: Modulates sinoatrial node automaticity in mice .

Research Tools and Reagents

Commercially available recombinant CCKAR tools enable targeted studies:

Product TypeExamplesApplications
Recombinant proteinsCCKAR (aa 248-298) fragment Antibody validation, blocking
AntibodiesCSB-PA070163, ab42262 WB, IHC, ELISA
Cell linesHEK293-CCKAR stable lines Drug screening, signaling assays

These reagents have been validated in:

  • Cancer studies: High CCKAR expression correlates with brain metastases in NSCLC (HR=3.24, p<0.001) .

  • Cardiovascular research: Cckar knockout mice show altered heart rate variability .

Therapeutic Targeting and Challenges

Despite clinical setbacks, CCKAR remains a drug development focus:

Recent advances:

  • Small-molecule agonists: A-71623 (IC~50~ 3.7 nM, 1,200× CCKBR selectivity)

  • Antagonists: Devazepide (K~i~ 0.3 nM) and lintitript in crystallography studies

  • Biased signaling: NN9056 agonist stabilizes unique TM6 conformation for Gq preference

Obstacles:

  • Receptor dimerization with CCKBR alters signaling outcomes

  • Species-specific ligand affinity complicates translational models

Emerging Research Applications

  1. Oncology: CCKAR overexpression promotes NSCLC metastasis via β-arrestin pathways .

  2. Metabolic disorders: Allosteric modulators show promise for obesity treatment .

  3. Structural biology: Cryo-EM maps at 2.4–3.1 Å resolution guide drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
CCKAR; CCKRA; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH MSASVPPQ
Uniprot No.

Target Background

Function
Cholecystokinin receptor type A (CCKAR) functions as a receptor for cholecystokinin. It plays a crucial role in pancreatic growth and enzyme secretion, as well as smooth muscle contraction of the gallbladder and stomach. Notably, CCKAR exhibits a 1000-fold higher affinity for cholecystokinin (CCK) compared to gastrin. This receptor also modulates feeding behavior and dopamine-induced responses in the central and peripheral nervous system. CCKAR mediates its effects through G protein coupling, which activates a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. CCK1R may play a role distinct from CCK2R in colon carcinogenesis. Nuclear CCK1R represents a potential biomarker for poor prognosis. PMID: 26508021
  2. Studies have shown downregulation of CCKAR gene expression in A1/A1 genotype of gallstone disease patients compared to controls, with significant variation in its expression pattern linked to polymorphism. PMID: 27287528
  3. Our study revealed significantly higher expression of CCKAR and downregulation of CCKBR in pancreatic cancer compared to controls, while CCKBR/GR was detected in a majority of stomach cancer samples. This suggests that CCK and Gs receptors may have diagnostic and therapeutic implications. PMID: 27072272
  4. The neurotransmitter cholecystokinin (CCK), along with its receptors, CCKAR and CCKBR, have been previously associated with psychiatric disorders, suggesting that variants near these genes may play a role in the pre-pulse/startle response in this cohort. PMID: 26608796
  5. CCK-AR polymorphism has been found to be protective against functional dyspepsia. PMID: 26551933
  6. There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development. PMID: 25875176
  7. Age-related differential expression of CCKAR in GBC may suggest two possible variants of the disease in this endemic belt. PMID: 25025063
  8. The Y140A mutation within a cholesterol-binding motif results in ligand binding and activity characteristics similar to wild type CCK1R in a high cholesterol environment. PMID: 24825903
  9. Findings suggest that variants in the CCKAR gene may influence the risk of gallbladder cancer in women. PMID: 23701593
  10. A significant association of the cholecystokinin-A receptor (CCKAR) gene variation rs1800857 and language lateralization has been reported. PMID: 23341962
  11. Results showed that three individual haplotypes of CCKAR were strongly associated with an increased risk of schizophrenia. PMID: 22825913
  12. Data suggest that CCK-1R expression is upregulated in kidney tubules (but not in glomeruli) in patients with diabetic nephropathy. Increased expression of CCK-1R in tubules appears to be a biomarker of the severity of proteinuria in these patients. PMID: 22396142
  13. Data may suggest that the TM3 CRAC cholesterol-binding motif could be responsible for the cholesterol sensitivity of the CCK1R. PMID: 22021636
  14. CCKAR expression was significantly increased in gallbladder cancer compared to gallstone disease. PMID: 21813391
  15. Data indicate that the Homo-Phe derivative 2 (VL-0797) enhanced the affinity for the rat CCK(1)-R by 12-fold and the human CCK(1)-R by 15-fold relative to the reference compound 12 (VL-0395). PMID: 21728335
  16. An association was not found between cholecystokinin A receptor polymorphisms and antipsychotic-induced weight gain in schizophrenia patients. PMID: 20732371
  17. LPS can upregulate the expression of CCK-AR and CCK-BR mRNA in vascular endothelial cells. PMID: 19751565
  18. A 2-marker haplotype (rs1800855/rs1800857) in the CCKAR gene protected women against PD (P=0.004). Additionally, we found two novel rare missense variations in the CCKBR gene (Lys329Asn and Pro446Leu) in two and one patient, respectively. PMID: 20023595
  19. An intron 1 polymorphism in the cholecystokinin A receptor gene is associated with schizophrenia in males. PMID: 19753663
  20. Significant association between polymorphism at the -85 locus of the CCKAR gene in patients with hallucinations, especially patients with hallucinations in delirium tremens. PMID: 12198366
  21. The presence of CCK receptors in human ductal pancreatic tumor samples is primarily due to CCK2 expression in residual pancreatic islets and CCK1 in pancreatic nerves. PMID: 12851875
  22. Heterodimerization of type A and B cholecystokinin receptors forms a powerful signaling unit with potential clinical significance in promoting cell growth. PMID: 14534299
  23. Both localization and functional studies suggest that the motor effects of cholecystokinin are mediated by CCK1/CCKA receptors in humans. PMID: 15100163
  24. CCK-AR gene polymorphism may be involved in the neurobiology of panic disorder. PMID: 15108185
  25. The CCK-AR gene is suggested to predispose individuals to schizophrenia. PMID: 15363473
  26. Analysis of partial and full agonism mediated by the human cholecystokinin-1 receptor. PMID: 15632187
  27. Significant differences in intelligence were found for Cholecystokinin A receptor gene promoter polymorphisms A-81G and G-128T in community-living Japanese individuals. PMID: 15723764
  28. The deficiency of CCK-R may be a key factor leading to the impairment of gallbladder motor function and the pathogenesis of cholesterol gallstone formation. PMID: 15786550
  29. A possible role of the CCK-AR gene in vulnerability to schizophrenia in patients with auditory hallucinations. PMID: 17413443
  30. No evidence was found for the association between the CCK-AR gene and schizophrenia in the Japanese population. PMID: 17413452
  31. The CCK-A receptor agonist, GI181771X, did not reduce body weight in obese patients, suggesting that CCK-A alone does not have a central role in long-term energy balance. PMID: 17597711
  32. Responses of human esophageal sphincter sling and clasp fibers to cholecystokinin (CCK) and gastrin through CCK-A and -B receptors have been reported. PMID: 18444993
  33. Effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation have been reported. PMID: 18776046

Show More

Hide All

Database Links

HGNC: 1570

OMIM: 118444

KEGG: hsa:886

STRING: 9606.ENSP00000295589

UniGene: Hs.129

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of CCKAR and what are its key structural domains?

CCKAR belongs to the G-protein-coupled receptor (GPCR) superfamily, specifically the β-branch of the rhodopsin family. The receptor consists of seven transmembrane segments with distinct functional domains including cholesterol recognition/interaction amino acid consensus (CRAC) motifs and cholesterol consensus motif (CCM) sequence motifs. Key structural features include the conserved "micro-switches" (PIF, ERY, CWxP, and NPxxY) that are typical of active GPCRs. These structural elements undergo significant conformational changes during activation, including an approximately 9-Å outward movement of TM6 and a 4-Å inward shift of TM7 compared to inactive states . The carboxyl terminus of CCKAR contains multiple serine and threonine residues that play critical roles in receptor internalization and signaling regulation .

What is the mechanism of ligand recognition by CCKAR?

CCKAR recognizes its endogenous ligand cholecystokinin, particularly the sulfated octapeptide form (CCK-8). Structural studies have revealed that CCK-8 binding involves specific interactions with residues in the transmembrane helices and extracellular domains of CCKAR. The sulfation of CCK-8 is particularly important for high-affinity binding. When CCK-8 binds to CCKAR, it stabilizes the active conformation of the receptor, which then allows for G-protein coupling and subsequent signal transduction. Specific binding pockets within transmembrane segments, particularly TM3, play critical roles in agonist recognition . The ligand binding triggers conformational changes that propagate through the receptor structure to affect the orientation of intracellular domains, particularly the movement of TM6 away from the receptor core .

What are the optimal expression systems for recombinant human CCKAR production?

Chinese hamster ovary (CHO) cells have been established as an effective expression system for recombinant human CCKAR. These cells can be transfected using lipid-based methods such as Lipofectamine LTX with vectors containing the CCKAR cDNA and a selection marker like the neomycin resistance gene . When properly optimized, this system can provide up to 25-fold higher receptor density compared to native pancreatic acinar cells, making it ideal for structural and functional studies .

For successful expression, researchers should:

  • Use expression vectors with strong promoters (like SRa)

  • Optimize transfection conditions specifically for CCKAR

  • Establish stable cell lines through antibiotic selection

  • Verify receptor expression through radioligand binding assays

  • Select cell clones with appropriate receptor densities (typically in the range of 60-300 × 10³ receptors/cell)

How can researchers verify proper expression and folding of recombinant CCKAR?

Verification of proper CCKAR expression and folding requires multiple complementary approaches:

  • Radioligand binding assays: Using 125I-BH-CCK-8 to determine receptor density and binding affinity. Properly folded receptors should demonstrate specific high-affinity binding with IC50 values between 0.3-0.7 nM for CCK-8 .

  • Functional assays: Calcium mobilization assays using calcium-sensitive dyes like Fura Red/AM can verify signal transduction capacity. Properly folded receptors should respond to ligand stimulation with appropriate calcium flux .

  • Biochemical characterization: Affinity labeling followed by SDS-PAGE analysis can identify receptor proteins. Deglycosylation experiments using endoglycosidase F can confirm core protein sizes .

  • Confocal microscopy: Using fluorescently-labeled ligands (like RG-CCK-8) to visualize receptor localization and internalization .

  • Sensitivity to GTP analogs: Functional recombinant CCKAR should demonstrate appropriate sensitivity to stable GTP analogs, similar to native receptors .

How do glycosylation patterns differ between native and recombinant CCKAR, and how does this affect functional studies?

Native and recombinant CCKAR show notable differences in glycosylation patterns despite having the same core protein size. Biochemical characterization has revealed that while both native and recombinant forms represent complex glycoproteins, only the native receptor binds to Ulex europeus agglutinin I, a lectin that recognizes fucose residues added during late glycoprotein biosynthesis . This suggests differences in terminal glycosylation steps between expression systems.

Despite these structural differences in glycosylation, functional studies demonstrate that recombinant CCKAR in CHO cells is functionally indistinguishable from native pancreatic acinar cell receptors. This functional equivalence includes:

  • Similar ability to initiate signaling cascades

  • Comparable sensitivity to stable GTP analogues

  • Equivalent binding affinities for both agonists and antagonists

These findings indicate that while glycosylation differences may affect electrophoretic mobility (with recombinant CCKAR migrating faster on SDS-PAGE than the native M(r) 85,000-95,000 molecule), they do not significantly impact the receptor's pharmacological properties. This makes recombinant systems valid models for studying CCKAR function despite glycosylation differences .

What are the recommended methodologies for studying CCKAR internalization?

Studying CCKAR internalization requires specialized techniques to track receptor trafficking following ligand binding. Based on established protocols, the following methodologies are recommended:

  • Acid wash/radioligand stripping assays: Cells expressing CCKAR are incubated with radiolabeled ligand (e.g., 125I-BH-CCK-8) for various time periods. Surface-bound ligand is then stripped using an acidic buffer (pH 2.0-3.0), allowing quantification of internalized vs. surface-bound ligand .

  • Confocal microscopy visualization: This approach provides direct visualization of internalization dynamics. Cells are incubated with fluorescently-labeled CCK (e.g., rhodamine green-labeled CCK-8) while cell membranes are counterstained with rhodamine B-labeled concanavalin A. Overlaid images can distinguish surface-localized from internalized receptors:

    • Yellow coloration indicates surface colocalization

    • Green intracellular fluorescence indicates internalized receptor-ligand complexes

  • Flow cytometry: This method can be used to quantify receptor surface expression before and after ligand exposure .

  • Mutation studies: To investigate the molecular determinants of internalization, researchers can generate truncation mutants (e.g., CCKAR Tr399) or serine/threonine-to-alanine mutants (e.g., CCKAR ΔS/T) to assess the role of specific residues in the carboxyl terminus .

When designing internalization studies, it's important to include appropriate time courses (typically 5-60 minutes) and controls (such as temperature controls, since internalization is temperature-dependent) .

What techniques are most effective for measuring CCKAR-mediated signaling pathways?

Several complementary techniques can effectively measure CCKAR-mediated signaling:

  • Calcium mobilization assays: Cells loaded with calcium-sensitive dyes (e.g., Fura Red/AM at 4 μg/ml) can detect intracellular calcium flux upon receptor activation. This requires:

    • Incubation with dye for 45 minutes at 37°C in calcium-containing buffer

    • Rest period of 30 minutes at room temperature

    • Real-time measurement using flow cytometry or plate readers

    • Baseline measurement followed by agonist addition

  • Phosphorylation assays: Western blotting to detect phosphorylation of downstream effectors like ERK1/2, PKC, or other kinases activated by Gq, Gs, or Gi coupling.

  • cAMP assays: For measuring Gs (stimulatory) or Gi (inhibitory) coupling effects on adenylyl cyclase activity.

  • Reporter gene assays: Constructs containing response elements for transcription factors activated by CCKAR signaling can provide longer-term readouts of receptor activity.

  • GTPγS binding assays: To measure direct G-protein activation by the receptor.

Experimental design should account for CCKAR's promiscuous G-protein coupling ability (Gs, Gi, and Gq) , as different cell types may show different predominant coupling patterns. Additionally, membrane cholesterol content significantly affects CCKAR signaling and should be controlled or measured in experimental setups .

How can researchers effectively modify CCKAR expression levels for functional studies?

Researchers can employ several strategies to modulate CCKAR expression levels:

  • Stable transfection: For long-term studies, establishing stable cell lines with varying receptor densities through antibiotic selection pressure. Cell clones can be selected based on receptor density determined by radioligand binding (typical ranges: 26-291 × 10³ receptors/cell) .

  • Inducible expression systems: Tetracycline-regulated or similar inducible promoter systems allow for controlled, titratable receptor expression.

  • Inflammatory stimulation: In cells that naturally express CCKAR (such as immune cells), stimulation with pathogen-associated molecular patterns like lipopolysaccharide (LPS) can upregulate CCKAR expression. For example, overnight stimulation with LPS (1 μg/ml) has been shown to increase CCKAR expression in peripheral blood mononuclear cells .

  • siRNA or shRNA knockdown: For reducing expression in cells with endogenous CCKAR.

  • CRISPR/Cas9 gene editing: For complete knockout or precise modification of the CCKAR gene.

When modifying expression levels, it's critical to verify:

  • Actual receptor density using binding assays

  • Maintained binding affinity for ligands (IC50 should remain in the 0.3-0.7 nM range for CCK-8)

  • Proper subcellular localization

  • Normal signaling capacity relative to expression level

How does the Y140A mutation affect CCKAR function and what are its research applications?

The Y140A mutation in CCKAR, located within a cholesterol-binding motif and the conserved (E/D)RY signature sequence, creates a unique tool for studying receptor function in different cholesterol environments. This mutation produces a receptor phenotype that mimics wild-type CCKAR in a high cholesterol environment regardless of the actual membrane cholesterol content .

Key characteristics of the Y140A mutant include:

  • Ligand binding and activity profiles similar to wild-type CCKAR in high cholesterol

  • Altered sensitivity to various ligand chemistries

  • Modified internalization patterns

  • Changed sensitivity to GTP analogs

  • Distinct anisotropy patterns with fluorescent CCK analogs

Research applications of this mutant include:

  • Serving as a stable and cost-effective alternative to model systems that physically enhance membrane cholesterol

  • Providing a screening platform for identifying positive allosteric modulators that might correct conformational changes induced by high cholesterol environments

  • Investigating receptor-G protein coupling defects in metabolic syndrome

  • Structure-function studies relating to cholesterol sensitivity

  • Understanding how TM3 residues contribute to allosteric ligand binding

The Y140A mutation appears to pull the agonist trigger away from its Leu356 target on TM7, creating a distinct conformation of the intramembranous pocket that offers opportunities for pharmacological intervention .

What structural determinants control G-protein coupling selectivity in CCKAR?

CCKAR demonstrates promiscuous G-protein coupling ability, interacting with Gs, Gi, and Gq heterotrimers. Cryo-EM structural studies have provided insights into the structural determinants controlling this selectivity:

How do membrane cholesterol levels impact CCKAR structure and function?

Membrane cholesterol levels significantly impact CCKAR structure and function through specific interactions with cholesterol-binding domains. The effects include:

  • Altered ligand binding: High cholesterol environments negatively affect CCK binding affinity and kinetics.

  • Modified G-protein coupling: High cholesterol creates a receptor-G protein coupling defect, potentially contributing to altered signaling in metabolic syndrome.

  • Structural changes: Cholesterol interacts with specific receptor domains, particularly those encoded by the third exon including most of transmembrane segments three and four.

  • Cholesterol-binding motifs: CCKAR contains both "cholesterol recognition/interaction amino acid consensus" (CRAC) and "cholesterol consensus motif" (CCM) sequence motifs. Key residues include Tyr140 (Y3.51) in TM3 and Tyr237 (Y5.66) in an additional CRAC motif in TM5 .

  • Mutational effects: Mutation of these key tyrosine residues to alanines negatively affects CCK binding and signaling. Notably, the Y140A mutation uniquely eliminates cholesterol sensitivity of CCKAR .

These findings suggest that cholesterol directly modulates CCKAR conformation through specific binding interactions rather than through general membrane effects. This has important implications for understanding CCKAR function in conditions with altered cholesterol metabolism, such as metabolic syndrome. The Y140A mutant provides a valuable tool for studying these effects by mimicking the high-cholesterol receptor conformation in normal cholesterol environments .

What is the role of CCKAR in immune cells and its potential immunomodulatory functions?

CCKAR expression has been identified in various immune cells and tissues, suggesting important immunomodulatory functions beyond its classical roles in the gastrointestinal system. Research has demonstrated:

  • Expression pattern: CCKAR protein has been detected in peripheral blood mononuclear cells (PBMC) including monocytes, and CCKAR gene expression has been found in primary lymphoid organs (thymus, bursa) and secondary lymphoid tissues (spleen) .

  • Regulation by inflammatory stimuli: CCKAR expression in immune cells can be modulated by pathogen-derived inflammatory stimuli such as lipopolysaccharide (LPS), suggesting a role in immune responses .

  • Calcium signaling: Functional CCKAR in immune cells couples to calcium mobilization pathways, as demonstrated by loading cells with calcium-sensitive dyes like Fura Red/AM and measuring responses to receptor crosslinking .

  • Immunological functions: In mammals, CCK/CCKAR interactions affect multiple immunological parameters including:

    • Regulation of lymphocyte functions

    • Modulation of monocyte activities

    • Potential influence on inflammatory responses

  • Connection to appetite regulation: The immunomodulatory functions of CCKAR provide a potential mechanistic link between infection, inflammation, and altered food intake/growth during immune challenges .

These findings suggest that CCKAR may serve as an important communication node between the nervous, endocrine, and immune systems, potentially coordinating metabolic and immune responses during physiological and pathological conditions .

What are the key considerations for developing drugs targeting CCKAR for obesity treatment?

  • Efficacy and safety concerns: Despite multiple candidates entering clinical trials, none has been approved so far due to limited efficacy and safety issues .

  • Structural understanding: Precise structural information about ligand recognition and receptor activation is essential for rational drug design. Recent cryo-EM structures of CCK-8–CCK AR–G protein complexes provide important insights into these mechanisms .

  • G-protein signaling selectivity: CCKAR couples with multiple G-protein subtypes (Gs, Gi, Gq). Understanding which signaling pathway is most relevant for appetite suppression versus side effects is crucial for developing biased ligands with improved therapeutic profiles .

  • Cholesterol sensitivity: CCKAR function is significantly affected by membrane cholesterol levels, which are often elevated in obesity and metabolic syndrome. Drugs may need to correct the conformational changes induced by high cholesterol environments .

  • Positive allosteric modulators: Development of intrinsically inactive positive allosteric modulators represents an attractive approach to minimize side effects while enhancing endogenous CCK signaling .

  • Screening tools: The Y140A mutant of CCKAR provides a valuable tool for screening compounds that might correct the coupling defect observed in high cholesterol environments, potentially leading to more effective therapeutics for metabolic syndrome .

Understanding these considerations through advanced structural and functional studies of CCKAR will be essential for developing more effective and safer anti-obesity medications targeting this receptor .

How do carboxyl terminus modifications affect CCKAR internalization and signaling dynamics?

The carboxyl terminus of CCKAR plays a critical role in regulating receptor internalization and signaling dynamics. Experimental modifications of this domain have revealed:

  • Truncation effects: Studies with truncated CCKAR (CCKAR Tr399) have demonstrated that despite significant shortening of the C-terminus, the receptor maintains normal internalization capabilities. This suggests that the minimal sequences necessary for internalization are preserved in this truncated form .

  • Serine/threonine phosphorylation sites: The C-terminus contains multiple serine and threonine residues that serve as potential phosphorylation sites by G protein-coupled receptor kinases (GRKs) and other kinases. Mutation of all these residues to alanines (CCKAR ΔS/T) does not prevent receptor internalization, suggesting phosphorylation-independent mechanisms may be involved .

  • Receptor binding properties: Despite these modifications, both truncated and serine/threonine-mutated receptors maintain similar binding affinities for CCK-8 (IC50s between 0.37 ± 0.11 and 0.7 ± 0.02 nM), comparable to wild-type receptors .

  • Visualization of internalization: Confocal microscopy studies using fluorescent ligands show that both wild-type CCKAR and the modified versions (CCKAR Tr399 and CCKAR ΔS/T) effectively internalize ligand within 15 minutes, moving it from the cell surface to the interior of the cell .

These findings contradict the common paradigm for GPCR internalization, which often depends on C-terminal phosphorylation. CCKAR appears to utilize alternative mechanisms for internalization, which has implications for understanding its signaling regulation, desensitization processes, and potential for therapeutic targeting .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.