Recombinant Human Cholesterol 25-hydroxylase (CH25H)

Shipped with Ice Packs
In Stock

Description

Structure and Biochemical Properties

Recombinant CH25H is a full-length protein spanning amino acids 1–272, typically expressed in systems like wheat germ or insect cells . Key properties include:

  • Catalytic Activity: Converts cholesterol to 25HC through hydroxylation at the C25 position .

  • Stability: Maintains enzymatic activity under standard laboratory conditions, enabling functional studies in vitro .

  • Applications: Used in ELISA, Western blotting, and biochemical assays to study 25HC production and downstream signaling .

Lipid Metabolism and Immune Regulation

CH25H regulates cholesterol homeostasis and modulates immune responses:

  • LXR Activation: 25HC binds liver X receptor (LXR), suppressing cholesterol biosynthesis and promoting efflux via ABCA1/APOE pathways .

  • Efferocytosis: In alveolar macrophages, 25HC supports phagocytosis of apoptotic neutrophils, resolving lung inflammation .

  • Inflammatory Modulation:

    • Anti-inflammatory: Supresses inflammasome activation and promotes M2 macrophage polarization .

    • Proinflammatory: Induces CCL5 release in macrophages, amplifying cytokine responses during LPS exposure .

Antiviral Activity

CH25H and 25HC exhibit broad antiviral effects against enveloped viruses:

VirusMechanismKey FindingsSources
SARS-CoV-2Depletes plasma membrane cholesterol via ACAT activationBlocks viral fusion; reduces infection in lung organoids
VSV, SARS-CoVSuppresses membrane fusion and replicationCH25H overexpression inhibits viral entry
MERS-CoVBroad-spectrum inhibition via 25HC25HC restricts viral membrane fusion

Mechanistic Insight: 25HC activates acyl-CoA:cholesterol acyltransferase (ACAT), sequestering cholesterol into lipid droplets, thereby limiting viral fusion .

Neuroinflammation and Neurodegeneration

In Alzheimer’s disease (AD) and tauopathy models:

  • CH25H Deficiency: Reduces 25HC levels, attenuating microglial activation and tau-mediated neurodegeneration in PS19 mice .

  • Transcriptomic Changes: Suppression of proinflammatory pathways (e.g., NF-κB, Jak/STAT) and restoration of sterol biosynthesis in CH25H-deficient mice .

ModelObservationOutcomeSource
PS19 Tau MiceCH25H deficiency ↓ neuroinflammation↓ Microgliosis, astrogliosis, and hippocampal atrophy
LPS-Treated MacrophagesCH25H ↑ CCL5 releaseEnhanced chemokine response to LPS

Pulmonary Inflammation

  • LPS-Induced Lung Injury: CH25H deletion impairs efferocytosis, delaying neutrophil clearance and exacerbating inflammation .

  • LXR Dependency: Pharmacologic LXR activation rescues resolution deficits in CH25H-deficient mice .

Therapeutic Potential

  • Antiviral Therapy: 25HC’s safety profile and broad-spectrum efficacy position it as a candidate for COVID-19 and emerging viral threats .

  • Neurodegenerative Diseases: Targeting CH25H may mitigate neuroinflammation in AD and tauopathies .

  • Challenges:

    • Selectivity: Dual pro-/anti-inflammatory roles necessitate context-specific modulation.

    • Delivery: Systemic administration of 25HC or CH25H may require optimization for tissue targeting.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment of the format currently in stock. If a specific format is required, please indicate this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please specify it in your order; we will prioritize development accordingly.
Synonyms
CH25H; Cholesterol 25-hydroxylase; Cholesterol 25-monooxygenase; h25OH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CH25H
Target Protein Sequence
MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDI LCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPE LLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELF SLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHD LHHSHFNCNFAPYFTHWDKILGTLRTASVPAR
Uniprot No.

Target Background

Function
Cholesterol 25-hydroxylase (CH25H) catalyzes the conversion of cholesterol to 25-hydroxycholesterol, which in turn represses cholesterol biosynthesis enzymes. It plays a critical role in cell positioning and movement within lymphoid tissues, as 25-hydroxycholesterol is a precursor to 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC). 7-alpha,25-OHC acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for various lymphoid cells. CH25H may also regulate lipid metabolism by synthesizing a corepressor that inhibits sterol regulatory element-binding protein (SREBP) processing. As an interferon-stimulated gene, CH25H exhibits broad antiviral activity against numerous enveloped viruses, including vesicular stomatitis virus (VSV) and SARS-CoV-2. Its product, 25-hydroxycholesterol, activates the endoplasmic reticulum (ER)-localized enzyme ACAT, inducing internalization of plasma membrane cholesterol and restricting SARS-CoV-2 spike protein-mediated fusion, thus inhibiting viral replication. In the testis, macrophage-produced 25-hydroxycholesterol contributes to Leydig cell differentiation.
Gene References Into Functions
  1. 25-hydroxycholesterol (25HC) inhibits mammalian reovirus entry by affecting endosomal membrane dynamics. PMID: 29950420
  2. 25-HC induces calcium and cholesterol transients in human spermatozoa, potentially influencing the acrosomal reaction. PMID: 27912195
  3. Genetic studies have identified a rare CH25H mutation associated with neuromyelitis optica. PMID: 26857497
  4. Hepatitis C virus (HCV) infection upregulates CH25H expression. PMID: 25999047
  5. CH25H plays a role in the innate immune response to HCV infection by regulating lipid metabolism. PMID: 25903345
  6. Type I interferons regulate CH25H production in dendritic cells and macrophages. PMID: 20699362
  7. CH25H is a candidate risk factor for Alzheimer's disease. PMID: 16157450
Database Links

HGNC: 1907

OMIM: 604551

KEGG: hsa:9023

STRING: 9606.ENSP00000360918

UniGene: Hs.47357

Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Cholesterol 25-hydroxylase (CH25H) and what is its primary function?

Cholesterol 25-hydroxylase (CH25H) is an enzyme that catalyzes the monooxygenation of cholesterol into 25-hydroxycholesterol (25HC). It functions as a critical enzyme induced by type I interferons and plays significant roles in both lipid metabolism and immune regulation . The primary catalytic function involves converting cholesterol to 25HC, which subsequently affects multiple biological processes including inhibition of cholesterol biosynthesis, regulation of membrane fusion, and modulation of immune responses .

The biological activity of CH25H extends beyond basic metabolism to influence inflammatory processes, viral defense mechanisms, and tumor suppression. In the context of pancreatic ductal adenocarcinoma (PDAC), for example, CH25H has been identified as a potential tumor suppressor, with its gene methylation and decreased expression associated with poor prognosis in human pancreatic cancers .

How does 25-hydroxycholesterol (25HC) exert its biological effects?

25-hydroxycholesterol (25HC), the product of CH25H activity, functions through several distinct mechanisms:

Second, 25HC mobilizes accessible cholesterol from the plasma membrane, altering cholesterol orientation and solvent accessibility . This mobilization triggers cholesterol trafficking from the plasma membrane to the endoplasmic reticulum, affecting membrane composition and function.

Third, in immune contexts, 25HC can modulate T cell activation. Studies have shown that 25HC impairs the viability and proliferation of T cells during early stages of TCR activation by impeding cellular cholesterol biosynthesis . This effect is time-sensitive, occurring primarily within the first 48 hours of T cell activation.

Additionally, 25HC exhibits antiviral properties by blocking coronavirus entry and spike-mediated membrane fusion through its effects on membrane cholesterol organization . In intestinal epithelial cells, 25HC helps maintain gut barrier function through the induction of specific genes like ATF3 .

What are the optimal storage and handling conditions for recombinant CH25H?

Recombinant human CH25H protein requires specific storage and handling conditions to maintain stability and functionality:

The protein should be stored at -80°C for long-term preservation . When working with the protein, it's crucial to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and enzymatic activity .

For applications in cell culture, the protein solution should be filtered before use, although researchers should be aware that some protein loss may occur during the filtration process . The standard buffer composition for recombinant CH25H includes 25 mM Tris-HCl, 100 mM glycine at pH 7.3, with 10% glycerol as a cryoprotectant .

When planning experiments that require extended use of the protein, consider aliquoting the stock solution into single-use volumes to minimize freeze-thaw cycles. Under proper storage and handling conditions, recombinant CH25H remains stable for approximately 12 months from the date of receipt .

What expression systems are most effective for producing functional recombinant CH25H?

The production of functional recombinant CH25H requires an expression system that ensures proper protein folding, post-translational modifications, and enzymatic activity. Based on available data, HEK293T cells represent an effective mammalian expression system for human CH25H production . This human cell line provides the cellular machinery necessary for proper folding and potential post-translational modifications required for CH25H functionality.

Expression constructs typically include affinity tags such as C-Myc/DDK (FLAG) to facilitate purification through affinity chromatography followed by conventional chromatography steps . The recombinant CH25H produced in this system has a predicted molecular weight of approximately 31.6 kDa .

The purification process typically involves capturing the protein through anti-DDK affinity columns followed by additional chromatography steps to achieve >80% purity as determined by SDS-PAGE and Coomassie blue staining . This approach yields recombinant protein at concentrations greater than 0.05 μg/μL as determined by microplate BCA methods .

How can researchers verify and measure the enzymatic activity of recombinant CH25H?

Verifying the enzymatic activity of recombinant CH25H involves demonstrating its ability to convert cholesterol to 25-hydroxycholesterol (25HC). Several methodological approaches can be employed:

Gas chromatography-mass spectrometry (GC-MS) represents one of the most sensitive and specific analytical methods for 25HC quantification . In this approach, lipids are extracted from cells or culture media, and the conversion of cholesterol to 25HC can be measured with high precision, as demonstrated in studies measuring 25HC production by IL-27-stimulated CD4+ T cells .

For monitoring intracellular cholesterol levels as an indirect measure of CH25H activity, the Amplex Red Cholesterol Assay Kit has been effectively employed in research settings . This fluorometric method allows for the determination of total cholesterol content, which is then normalized to total cellular protein quantified by BCA protein assay .

Cell-based functional assays can also be used to verify CH25H activity. For example, researchers can test whether cells expressing recombinant CH25H exhibit reduced intracellular cholesterol levels compared to control cells, or whether the culture media from these cells contains 25HC that can inhibit cholesterol biosynthesis in reporter cell lines.

What are effective approaches for studying CH25H's role in T cell regulation?

To study CH25H's role in T cell regulation, researchers can employ several experimental approaches based on the finding that CH25H expression in CD4+ T cells modulates T cell activation:

  • Cytokine-induced CH25H expression: IL-27, particularly in combination with TGF-β, robustly induces CH25H expression in CD4+ T cells . This experimental system allows for the investigation of physiological CH25H regulation. The standard protocol involves isolating naive CD4+ T cells, stimulating them with anti-CD3/anti-CD28 antibodies in the presence of IL-27 and TGF-β, and measuring CH25H expression and 25HC production over time .

  • Paracrine effect analysis: To study how CH25H-expressing T cells affect bystander T cells, a two-stage culture system can be employed. First, wild-type T cells are activated with TCR crosslinking in the presence of IL-27+TGF-β to generate CH25H-expressing effector cells. After removing these cells, CFSE-labeled responder T cells (preferably CH25H-deficient or unable to respond to the inducing stimuli) are introduced to the conditioned medium . This approach allows researchers to specifically examine paracrine effects while controlling for autocrine production of 25HC.

  • Time-course experiments: Since the inhibitory effect of 25HC on T cell activation is time-dependent (most effective within the first 48 hours of activation), time-course experiments are essential . Adding exogenous 25HC at different time points after T cell activation allows for precise determination of the temporal window during which T cells are susceptible to 25HC-mediated inhibition.

These methodological approaches provide powerful tools for dissecting the complex role of CH25H in T cell regulation, revealing its function as a metabolic switch that constrains T cell activation through paracrine mechanisms.

How can researchers effectively modulate CH25H expression or activity in cellular models?

Several complementary approaches can be employed to modulate CH25H expression or activity in cellular models:

For genetic manipulation, CRISPR-Cas9 technology enables precise knockout of the CH25H gene, as exemplified in studies using Ch25h-/- mice and derived cellular models . This approach provides a complete loss-of-function model to investigate CH25H-dependent processes.

For overexpression studies, expression vectors containing the CH25H coding sequence can be transfected into target cells, often with epitope tags like HA or Myc/DDK to facilitate detection and purification . This approach allows for studying the effects of increased CH25H activity in various cellular contexts.

Physiological regulation of endogenous CH25H can be achieved through cytokine treatment. Type I interferons and IL-27 (especially in combination with TGF-β) effectively induce CH25H expression in appropriate cell types . This approach mimics natural regulatory mechanisms and may be preferable for studying physiological contexts.

To modulate CH25H activity rather than expression, researchers can bypass the enzyme by directly applying exogenous 25HC to cellular systems. Typically, 25HC is dissolved in 100% ethanol to make a concentrated stock solution (e.g., 4mM) and then diluted to working concentrations (around 4μM) in serum-free media . When using this approach, vehicle controls (ethanol) should be included, and researchers should be aware that the timing of 25HC addition significantly impacts its biological effects .

How does CH25H function as a tumor suppressor in pancreatic cancer?

CH25H functions as a tumor suppressor in pancreatic ductal adenocarcinoma (PDAC) through multiple interconnected mechanisms:

First, CH25H catalyzes the conversion of cholesterol to 25HC, which inhibits cholesterol biosynthesis . Since PDAC cells are highly dependent on cholesterol for growth and survival (cholesterol dependence is an essential characteristic of PDAC), this metabolic function directly antagonizes tumor progression .

Second, methylation of the CH25H gene and decreased CH25H expression occurs in human pancreatic cancers and correlates with poor prognosis . Experimental studies have demonstrated that knockout of Ch25h in mice accelerated progression of Kras-driven pancreatic intraepithelial neoplasia, directly supporting its tumor-suppressive role .

Third, CH25H loss promotes autophagy in PDAC cells, resulting in downregulation of MHC-I molecules and decreased CD8+ T cell tumor infiltration . This indicates that normal CH25H expression supports antitumor immunity by enhancing tumor cell recognition by cytotoxic T cells.

Remarkably, restoration of CH25H expression in human and mouse PDAC cells decreased their viability under conditions of cholesterol deficit and decelerated tumor growth in immune-competent hosts . Even more significantly, re-expression of CH25H in PDAC cells combined with immune checkpoint inhibitors notably inhibited tumor growth, suggesting potential therapeutic applications .

What antiviral mechanisms does CH25H employ against coronaviruses?

CH25H exhibits potent antiviral activity against coronaviruses through several mechanisms centered on cholesterol metabolism:

The primary antiviral mechanism involves 25HC blocking coronavirus entry and spike-mediated membrane fusion by mobilizing accessible cholesterol from the plasma membrane . This mobilization changes the orientation and solvent accessibility of cholesterol molecules, disrupting the cholesterol-rich microdomains required for viral fusion processes.

Studies have demonstrated that 25HC enhances cholesterol esterification by activating acyl-CoA:cholesterol acyltransferase (ACAT), which triggers cholesterol transport from the plasma membrane to the endoplasmic reticulum . This depletion of accessible cholesterol from the plasma membrane interferes with the cholesterol-dependent fusion machinery that coronaviruses rely on for cell entry.

25HC has been shown to inhibit SARS-CoV-2 and other coronaviruses by specifically blocking spike protein-mediated cell-cell fusion, a process that mirrors viral entry . This inhibition appears to be broad-spectrum, affecting multiple coronaviruses that depend on similar cholesterol-dependent fusion mechanisms.

The timing of 25HC's effectiveness is critical - it is most potent when present during the initial stages of viral infection, suggesting that it primarily targets viral entry rather than post-entry replication steps . This finding has important implications for potential therapeutic applications, suggesting that CH25H-based interventions would be most effective as prophylactic or early-treatment strategies.

What role does CH25H play in inflammatory bowel diseases?

CH25H plays a protective role in inflammatory bowel diseases by maintaining epithelial gut barrier function and regulating inflammatory responses:

RNA-sequencing analysis has revealed up-regulation of CH25H in patients with active inflammatory bowel disease (IBD) . Animal models using CH25H-deficient mice have demonstrated that CH25H exerts critical effects on preserving epithelial gut barrier integrity during inflammation .

Mechanistically, CH25H influences the STATS/IL-6 signaling cascade in intestinal cells, a pathway known to play a crucial role in intestinal homeostasis and inflammation . The product of CH25H activity, 25-HC, demonstrates protective effects in experimental colitis models, suggesting that CH25H activation represents a potential endogenous mechanism to limit inflammatory damage in the intestinal environment.

At the molecular level, 25HC treatment of intestinal epithelial cells induces the expression of specific genes, most notably ATF3 (Activating Transcription Factor 3) and EGR1 (Early Growth Response Protein 1) . These transcription factors are known to regulate various cellular processes, including inflammatory responses. ATF3, in particular, was markedly reduced in experimental colitis in CH25H-deficient mice, suggesting it mediates the protective effects of CH25H in intestinal inflammation .

These findings suggest that CH25H and its product 25HC contribute to intestinal homeostasis and may represent potential therapeutic targets for inflammatory bowel diseases.

How does the timing of 25HC exposure affect its biological activities?

The timing of 25HC exposure critically determines its biological effects across multiple systems:

In T cell biology, the inhibitory effect of 25HC on cell viability is most pronounced when 25HC is present during the early stages of T cell receptor (TCR) activation (within the first 48 hours) . If 25HC addition is delayed by 48 or 72 hours after activation, it has no effect on T cell viability or proliferation . This temporal sensitivity creates an interesting regulatory dynamic: CH25H-expressing T cells themselves become refractory to the inhibitory effects of the 25HC they produce, since they begin producing 25HC only after passing through the sensitive early activation window .

Similarly, in antiviral contexts, 25HC is most effective when present during the initial stages of viral infection, primarily targeting viral entry rather than post-entry replication steps . This timing dependency reflects 25HC's mechanism of action - mobilizing accessible cholesterol from the plasma membrane to disrupt the cholesterol-rich microdomains required for viral fusion .

These temporal dynamics have important implications for experimental design when studying CH25H functions. Time-course experiments are essential, and the addition of exogenous 25HC must be carefully timed relative to cellular activation events or viral infection to observe the full spectrum of its biological activities.

How do epigenetic mechanisms regulate CH25H expression in different disease contexts?

Epigenetic regulation of CH25H expression represents a critical control point that influences its biological functions in both normal physiology and disease states:

In pancreatic ductal adenocarcinoma (PDAC), methylation of the CH25H gene has been identified as a key epigenetic mechanism leading to decreased CH25H expression . This epigenetic silencing correlates with poor prognosis in human pancreatic cancers, suggesting that loss of CH25H function contributes to disease progression .

The epigenetic suppression of CH25H provides cancer cells with multiple advantages, including enhanced cholesterol accumulation to support rapid proliferation and escape from immune surveillance through downregulation of MHC-I molecules . This suggests that epigenetic regulation of CH25H may be a common mechanism employed by cancer cells to promote growth and evade immune detection.

In normal physiological contexts, CH25H expression is dynamically regulated by cytokines, particularly type I interferons and IL-27 . This indicates that while epigenetic mechanisms may establish baseline expression capacity, acute transcriptional regulation occurs in response to inflammatory signals, creating a complex regulatory landscape.

Understanding these epigenetic regulatory mechanisms could potentially reveal therapeutic opportunities for modulating CH25H expression. For instance, in cancers where CH25H is epigenetically silenced, epigenetic modifying drugs might restore CH25H expression and its tumor-suppressive functions.

What are the most promising therapeutic applications based on CH25H research?

Research on CH25H has revealed several promising therapeutic applications across different disease contexts:

In cancer therapy, particularly for pancreatic ductal adenocarcinoma (PDAC), restoration of CH25H expression or function represents a potential strategy that could simultaneously target tumor metabolism and enhance anti-tumor immunity . The finding that re-expression of CH25H in PDAC cells, when combined with immune checkpoint inhibitors, notably inhibited tumor growth suggests that targeting CH25H pathways could enhance immunotherapy efficacy .

For viral infections, particularly coronaviruses, 25HC or stable analogs could be developed as antiviral agents . The broad-spectrum activity of 25HC against multiple coronaviruses through disruption of cholesterol-dependent fusion mechanisms suggests potential applications for both current and emerging coronavirus threats.

In inflammatory bowel diseases, harnessing the protective effects of CH25H could lead to novel therapeutic approaches . Targeting the pathways through which CH25H maintains epithelial gut barrier function, particularly the ATF3 pathway, might provide new strategies for managing intestinal inflammation.

For each of these potential applications, several approaches could be pursued:

  • Direct administration of 25HC or stable analogs

  • Development of small molecules that mimic 25HC's effects on specific pathways

  • Gene therapy approaches to restore or enhance CH25H expression in target tissues

  • Combination therapies that pair CH25H-based interventions with existing treatment modalities

The diverse biological functions of CH25H across metabolism, immunity, and disease make it a particularly versatile target for therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.