Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 1 (CMTM1)

Shipped with Ice Packs
In Stock

Description

Biological Functions in Cancer

CMTM1 exhibits dual roles in tumor biology, influencing both oncogenic and tumor-suppressive pathways:

Tumor-Promoting Effects

  • Breast Cancer: Isoform CMTM1-v17 enhances NF-κB activation, promoting proliferation and resistance to TNF-α-induced apoptosis in MDA-MB-231 cells .

  • Hepatocellular Carcinoma (HCC): High CMTM1 mRNA/protein levels correlate with shorter disease-free survival (HR = 2.475, P = 0.017) .

  • Salivary Adenoid Cystic Carcinoma: Elevated CMTM1 expression associates with tumor recurrence and metastasis .

Tumor-Suppressive Effects

  • Renal Cell Carcinoma: CMTM4 and CMTM5 induce G0-G1 or G1-S phase arrest via p21/p27 upregulation, suppressing proliferation .

Clinical and Prognostic Significance

CMTM1’s expression profile varies across cancers, impacting patient outcomes:

Cancer TypeExpression LevelPrognostic AssociationStudy
Hepatocellular Carcinoma↑ in 84% of tumor tissuesShorter survival in high-expression groups (P < 0.05)
Breast Cancer↑ in tumor vs. normal tissuesResistance to apoptosis; NF-κB pathway activation
GlioblastomaNo significant differenceHigher levels linked to poorer prognosis
Stomach Cancer↑ mRNA in tumor tissuesPotential diagnostic marker

Research Applications

Recombinant CMTM1 is utilized in:

  • Antibody Development: As an antigen for generating isoform-specific antibodies .

  • Mechanistic Studies: Investigating roles in chemotaxis, immune evasion, and receptor recycling .

  • Therapeutic Exploration: Targeting CMTM1-v17 in breast cancer and lymphoma models .

Future Directions

Current research focuses on:

  • Clarifying isoform-specific functions (e.g., CMTM1-v5’s pro-apoptotic role in lymphoma) .

  • Validating CMTM1 as a biomarker for early cancer detection and prognosis .

  • Developing small-molecule inhibitors targeting CMTM1’s MARVEL domain .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing that tag.
Synonyms
CMTM1; CKLFSF1; CKLF-like MARVEL transmembrane domain-containing protein 1; Chemokine-like factor superfamily member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CMTM1
Target Protein Sequence
MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFF ILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAV IVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA
Uniprot No.

Target Background

Gene References Into Functions
  1. High CMTM1_v17 expression has been associated with chemotherapy resistance in lung cancer. PMID: 28129775
  2. CMTM1 and 3 have been identified as priority targets in glioblastomas. Initial insights into the signaling pathways potentially modulated by these two genes, including growth factor receptor, Src family kinase, and WNT activation, have been presented. PMID: 25931111
  3. Studies have shown that CMTM1_v17 is highly expressed in human testis and numerous human tumor tissues and cell lines. This expression appears to enhance cell proliferation and resistance to tumor necrosis factor-alpha (TNF-alpha)-induced apoptosis in MDA-MB-231 breast cancer cells. PMID: 25175386
  4. Research has characterized the gene structure of CMTM1, mapping it to chromosome 16. Additionally, studies have identified alternative transcription start sites and demonstrated its expression in spermatocytes and testes. PMID: 15147728
  5. Novel findings indicate that the final intron/exon region of the CKLFSF1 gene contains a unique eukaryotic promoter capable of directing expression of the downstream gene, CKLFSF2. PMID: 15778092

Show More

Hide All

Database Links

HGNC: 19172

OMIM: 607884

KEGG: hsa:113540

STRING: 9606.ENSP00000368814

UniGene: Hs.15159

Protein Families
Chemokine-like factor family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in testis.

Q&A

What is CMTM1 and which gene family does it belong to?

CMTM1 is a member of the Chemokine-like factor (CKLF)-like MARVEL transmembrane domain-containing family (CMTMs), a gene family consisting of nine genes in total: CKLF and CMTM1 through CMTM8. This gene family was first discovered by Han et al. from Peking University Human Disease Gene Research Center in 2001. The functional characteristics of CMTM proteins position them between classical chemokines and members of the transmembrane 4 super family (TM4SF), partly due to their MARVEL domain with four transmembrane-helix architecture, which is associated with vesicle transport and membrane binding events .

What is the genomic location and structure of CMTM1?

CMTM1 is located on chromosome 16q21/16q22 and consists of 7 exons and 6 introns. It has 23 isoforms (CMTM1 v1-v23), with proteins of CMTM1 v1-16 and CMTM1 v17-23 encoded by open reading frame 1 and open reading frame 2, respectively. CMTM1 forms a gene cluster with CKLF and CMTM2-4 on chromosome 16q .

Where is CMTM1 predominantly expressed in normal tissues?

CMTM1 expression is tissue-specific and is predominantly expressed in testicular tissue. It plays a significant biological role in hematopoietic, immune, cardiovascular, and male reproductive systems. In the male reproductive system, CMTM1 is localized in spermatogonial cells and secreted into spermatogenic tubules to participate in male reproductive activities .

What methods are commonly used to detect CMTM1 expression in tissue samples?

Researchers typically employ multiple complementary techniques to analyze CMTM1 expression:

  • Immunohistochemistry (IHC): This method detects protein expression in tissue samples. The procedure involves:

    • Tissue preparation: Baking tissue microarrays at 60°C for 2 hours

    • Dewaxing with xylene and hydrating with gradient ethanol

    • Antigen retrieval using EDTA buffer (pH 8.0) under high pressure

    • Blocking endogenous peroxidase and non-specific binding

    • Incubation with CMTM1 primary antibody (e.g., from Abcam) overnight at 4°C

    • Application of goat anti-rabbit secondary antibody and visualization

  • Assessment of IHC results involves scoring both:

    • Percentage of positively stained cells (0 for ≤5%, 1 for 6-25%, 2 for 26-50%, 3 for 51-75%, and 4 for >75%)

    • Staining intensity (0 for uncolored, 1 for light yellow, 2 for brown, 3 for yellow-brown)

    • Final score calculation: multiplication of the two scores, with 0 defined as (-), 1-4 as (+), 5-8 as (++), and 9-12 as (+++)

  • Reverse Transcription Polymerase Chain Reaction (PCR): Used to detect mRNA expression levels of CMTM1 and its variants

  • Bioinformatics analysis using public databases such as The Cancer Genome Atlas (TCGA) and The Human Protein Atlas to analyze expression patterns across large datasets

How does CMTM1 expression in cancer tissues differ from normal tissues?

CMTM1 expression patterns vary by cancer type:

  • Hepatocellular Carcinoma (HCC):

    • mRNA analysis shows CMTM1 is upregulated in HCC tissues compared to normal liver tissues (p < 0.05)

    • Protein expression by IHC showed positive expression in 84% (63/75) of HCC tissues and 89.3% (67/75) of adjacent non-tumor tissues, indicating no significant difference at protein level (p = 0.079)

  • Multiple Cancers:

    • CMTM1-v17 is highly expressed in various tumors including breast, kidney, lung, ovarian, and liver cancers

    • Non-small cell lung carcinoma shows higher CMTM1-v17 levels than paracancerous tissue

    • CMTM1 is highly expressed in glioblastoma cells (A172 and U251MG)

    • Elevated expression in salivary adenoid cystic carcinoma cells (SACC-83)

This discrepancy between mRNA and protein expression in HCC may be due to different tumor sources, varying malignancy degrees, or different detection methods .

What is the prognostic significance of CMTM1 expression in hepatocellular carcinoma?

The prognostic value of CMTM1 in HCC presents an interesting paradox depending on how it's measured:

  • Based on TCGA database analysis:

    • Low expression of CMTM1 is associated with longer disease-free survival

    • The survival time of HCC patients in the CMTM1 high expression group was significantly shorter than in the low expression group

  • Based on IHC protein detection:

    • Surprisingly, the survival of HCC patients with CMTM1 negative expression was significantly lower than those with CMTM1 positive expression

    • This contradicts the mRNA expression findings from the TCGA database

  • Statistical validation:

    • COX proportional risk model identified CMTM1 as an independent prognostic factor for HCC patients

    • Adjusted Odds Ratio (OR) of 2.475 (P = 0.017, 95% CI = 1.179-5.194)

This data is presented in detail in the following table:

VariablesBWaldP-valueOR (adjusted)95% CI Lower95% CI Upper
CMTM10.9065.7400.0172.4751.1795.194

Note: OR adjusted for age and gender

Which clinicopathological characteristics correlate with CMTM1 expression in HCC patients?

Analysis of 75 HCC patients revealed:

  • Significant correlations:

    • Family history of HCC (p = 0.046)

    • TNM stage (p < 0.05)

  • No significant associations with:

    • Gender

    • Age

    • Smoking status

    • Alcohol intake

    • HBV infection

    • Liver cirrhosis

    • Serum alpha-fetoprotein (AFP)

    • Tumor diameter

    • Tumor number

    • Metastasis

The detailed correlations with family history are shown in this excerpt from the study data:

VariablesTotalCMTM1 stainingχ²P
PositiveNegative
HCC family history
No635673.977
Yes1284

What molecular mechanisms underlying CMTM1's roles in different cancers have been identified?

Several mechanisms have been identified across different cancer types:

  • Breast Cancer:

    • CMTM1-v17 enhances cellular proliferation

    • Prevents TNF-α-induced apoptosis by activating the NF-κB pathway

  • Non-Small Cell Lung Carcinoma:

    • Higher CMTM1-v17 levels may promote chemoresistance

    • Associated with poor prognosis

  • Glioblastoma:

    • Promotes cell proliferation and invasion

    • Verified through in vitro experiments with A172 and U251MG cell lines

  • Lymphoma:

    • CMTM1-v5 specifically induces human lymphoma cells apoptosis

    • May represent a novel therapeutic approach for lymphoma treatment

  • Salivary Adenoid Cystic Carcinoma (SACC):

    • May enhance anti-tumor metastasis effects

    • Expression differences observed between SACC without recurrence/metastasis and SACC-LM tissues with recurrence/metastasis

How should researchers design experiments to study CMTM1 function in cancer cells?

A comprehensive experimental approach should include:

  • Expression Analysis:

    • Compare CMTM1 mRNA expression using RT-PCR and protein expression using Western blot and IHC

    • Analyze all 23 isoforms to determine which variants are most relevant in your cancer model

    • Use both cancer cell lines and primary tumor tissues, paired with adjacent normal tissues

  • Functional Studies:

    • Generate overexpression and knockdown models using appropriate vectors (for overexpression) and siRNA/shRNA/CRISPR-Cas9 (for knockdown)

    • Conduct proliferation assays (MTT, colony formation)

    • Perform apoptosis assays (Annexin V/PI staining, TUNEL)

    • Evaluate migration and invasion (Transwell, wound healing)

    • Assess chemoresistance by treating with relevant chemotherapeutic agents

  • Mechanistic Investigations:

    • Analyze pathway activation with focus on NF-κB signaling

    • Perform co-immunoprecipitation to identify protein-protein interactions

    • Consider ChIP assays to identify transcriptional regulation

    • Investigate membrane localization and trafficking since CMTM1 contains the MARVEL domain associated with membrane apposition events

  • In Vivo Validation:

    • Generate xenograft models using stable CMTM1-modified cell lines

    • Analyze tumor growth, metastasis, and survival outcomes

    • Perform IHC on xenograft tissues to confirm maintained expression alterations

What are the key methodological considerations when analyzing CMTM1 in patient samples?

When analyzing patient samples:

  • Sample Collection and Preservation:

    • Collect matched tumor and adjacent normal tissues when possible

    • Consider flash freezing for RNA/protein extraction and formalin fixation for IHC

    • Document comprehensive clinicopathological information, including family history and TNM stage, which have shown significant correlations with CMTM1 expression

  • Expression Analysis:

    • Use multiple detection methods (IHC, PCR, Western blot) to prevent methodological bias

    • Standardize scoring systems for IHC using both staining intensity and percentage of positive cells

    • Define clear positivity thresholds (e.g., scores >4 for positive and ≤4 for negative, as used in published research)

  • Statistical Analysis:

    • Use chi-square tests to analyze relationships between CMTM1 expression and clinicopathological characteristics

    • Apply Kaplan-Meier model and log-rank tests to evaluate survival differences

    • Perform multivariate analysis using COX proportional risk model to determine if CMTM1 is an independent prognostic factor

    • Adjust for confounding variables such as age and gender

  • Sample Size Considerations:

    • Previous studies have noted limitations due to small sample sizes

    • Power calculations should be performed to ensure adequate sample numbers for detecting clinically meaningful differences

How should researchers reconcile conflicting findings regarding CMTM1's role in cancer?

Researchers should take a systematic approach to reconcile contradictions:

  • Distinguish Between mRNA and Protein Expression:

    • In HCC research, mRNA levels showed upregulation in cancer tissues (from TCGA), but protein levels showed no significant difference by IHC

    • These discrepancies may reflect post-transcriptional regulation mechanisms

  • Consider Isoform-Specific Effects:

    • CMTM1 has 23 different isoforms that may have distinct or even opposing functions

    • For example, CMTM1-v17 promotes proliferation in breast cancer, while CMTM1-v5 induces apoptosis in lymphoma

    • Always specify which isoform is being studied and avoid generalizing findings to all CMTM1 variants

  • Account for Tissue-Specific Effects:

    • The same protein may have different functions in different tissues

    • Use appropriate tissue-specific models and avoid extrapolating findings across cancer types

  • Analyze Cancer Subtypes:

    • Stratify analyses by cancer subtypes, grades, and stages

    • The significant association of CMTM1 with TNM stage suggests its effects may vary with disease progression

  • Integrate Multi-Omics Data:

    • Combine genomic, transcriptomic, proteomic, and clinical data

    • Consider using public databases like TCGA alongside laboratory experiments to increase sample size and diversity

Why might CMTM1 show different prognostic implications at mRNA versus protein levels?

This contradiction requires careful analysis:

How can CMTM1 research be advanced to develop potential therapeutic applications?

Several promising research directions include:

  • Isoform-Specific Targeting:

    • Develop tools to selectively target specific CMTM1 isoforms

    • Focus on CMTM1-v17 for cancers where it promotes proliferation

    • Explore therapeutic potential of CMTM1-v5 which induces lymphoma cell apoptosis

  • Combinatorial Approaches:

    • Investigate synergistic effects of CMTM1 modulation with conventional chemotherapy

    • Explore CMTM1's role in chemoresistance in non-small cell lung carcinoma

    • Test combinations with immunotherapy agents, particularly given CMTM1's presence in the immune system

  • Biomarker Development:

    • Validate CMTM1 as a prognostic biomarker for HCC through larger, multicenter studies

    • Develop standardized detection methods suitable for clinical implementation

    • Create predictive models incorporating CMTM1 status alongside other established prognostic factors

  • Mechanistic Investigations:

    • Elucidate the full signaling network of CMTM1 beyond NF-κB pathway

    • Investigate potential interactions with other CMTM family members

    • Explore the role of the MARVEL domain in membrane interactions and trafficking

What are the current technical limitations in CMTM1 research and how might they be overcome?

Several technical challenges exist:

  • Isoform Differentiation:

    • Current Challenge: Most antibodies cannot distinguish between the 23 CMTM1 isoforms

    • Solution: Develop isoform-specific antibodies and primers; use mass spectrometry for protein identification; employ CRISPR-Cas9 to create isoform-specific knockout models

  • In Vivo Models:

    • Current Challenge: Limited availability of appropriate animal models that recapitulate CMTM1 function

    • Solution: Generate transgenic mouse models with tissue-specific CMTM1 expression; develop PDX (patient-derived xenograft) models that preserve tumor heterogeneity

  • Clinical Sample Limitations:

    • Current Challenge: Studies note "small sample size" and "not comprehensive enough" patient information

    • Solution: Establish multi-center collaborations to increase sample size; implement standardized data collection protocols; create tissue banks with comprehensive clinical annotation

  • Contradictory Findings:

    • Current Challenge: Discrepancies between mRNA and protein expression data

    • Solution: Perform parallel analyses of paired samples using multiple techniques; standardize scoring and evaluation methods; conduct meta-analyses to identify consistent patterns across studies

What are the future research priorities for understanding CMTM1's role in hepatocellular carcinoma?

Based on current knowledge gaps, researchers should prioritize:

  • Mechanism Elucidation:

    • Determine how CMTM1 influences HCC development and progression

    • Identify key interaction partners and downstream effectors in HCC cells

    • Investigate how CMTM1 relates to established HCC risk factors and oncogenic pathways

  • Resolving Expression Discrepancies:

    • Conduct comprehensive analysis of both mRNA and protein expression in larger cohorts

    • Determine which measurement better predicts clinical outcomes

    • Investigate post-transcriptional and post-translational regulation of CMTM1 in HCC

  • Family History Connection:

    • Further explore the significant association between CMTM1 expression and HCC family history

    • Investigate potential inherited genetic factors that might influence CMTM1 expression

    • Consider germline versus somatic alterations affecting CMTM1 function

  • Therapeutic Development:

    • Evaluate CMTM1 as a druggable target in HCC

    • Test whether modulating CMTM1 can enhance sensitivity to existing HCC treatments

    • Develop delivery methods to target CMTM1 in the liver specifically

  • Validation Studies:

    • Perform validation studies with larger, diverse patient cohorts

    • Standardize detection and scoring methods for clinical application

    • Determine if CMTM1 "can be a single prognostic molecular marker" as suggested by current research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.