Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 2 (CMTM2)

Shipped with Ice Packs
In Stock

Description

Biological Functions

CMTM2 exhibits diverse roles in cellular and disease processes:

Tumor Suppression

CMTM2 acts as a tumor suppressor in multiple cancers:

  • Hepatocellular Carcinoma (HCC): Lower CMTM2 levels correlate with aggressive pathology and poor prognosis. Overexpression reduces tumor cell invasiveness .

  • Gastric Cancer: Higher CMTM2 expression in diffuse-type gastric cancer (linitis plastica) is linked to improved survival .

  • Salivary Gland Adenoid Cystic Carcinoma: Reduced recurrence and perineural invasion in CMTM2-expressing tumors .

Mechanisms:

  • Inhibits epithelial-mesenchymal transition (EMT) by regulating E-cadherin, β-catenin, and ZEB proteins .

  • Suppresses AP-1 and CREB pathways, critical for oncogenic signaling .

Regulation of Viral Pathogenesis

CMTM2 negatively regulates HIV-1 transcription:

  • HIV-1 LTR Activity: Inhibits long terminal repeat (LTR)-directed transcription via suppression of AP-1 and CREB .

  • Tat Resistance: Co-expression of HIV-1 Tat fails to reverse CMTM2-mediated AP-1/CREB inhibition .

Table 2: CMTM2 in Viral Pathogenesis

Viral PathogenMechanism of ActionClinical ImplicationSource
HIV-1Suppresses AP-1/CREB pathwaysPotential therapeutic target
HBVDownregulated by HBx via ubiquitin-proteasome degradationBiomarker for HBV-related diseases

Reproductive and Cellular Roles

  • Spermiogenesis: Essential for male fertility in mice; CMTM2-deficient males show impaired sperm development .

  • Hematopoiesis: Expressed in bone marrow and circulating blood cells, though specific functions remain under investigation .

Biomarker Potential

  • HBV-Related Diseases: Serum CMTM2 levels are significantly lower in chronic hepatitis B (CHB) patients versus healthy controls. Correlates negatively with HBV DNA load in CHB .

  • HCC Prognosis: Lower tissue CMTM2 expression predicts poor survival and advanced pathological grades .

Therapeutic Targeting

  • Cancer Therapy: Overexpression strategies could limit tumor invasion and metastasis .

  • Viral Inhibition: Modulating CMTM2 levels may suppress HIV-1 replication .

Research Tools and Availability

Recombinant CMTM2 is widely used in experimental studies:

  • Applications: Western blotting, protein interaction assays, and functional studies .

  • Commercial Sources: Available as GST- or His-tagged proteins (e.g., Creative Biomart, GeneBiosystems) .

Future Directions

  • Mechanistic Studies: Elucidating CMTM2’s role in EMT and viral regulation.

  • Clinical Trials: Exploring CMTM2 as a predictive biomarker in HCC and HBV.

  • Therapeutic Development: Targeting the ubiquitin-proteasome system to stabilize CMTM2 in HBV/HIV co-infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CMTM2; CKLFSF2; CKLF-like MARVEL transmembrane domain-containing protein 2; Chemokine-like factor superfamily member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CMTM2
Target Protein Sequence
MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKH EVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITM EISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLL AVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKP PGPAKGKK
Uniprot No.

Target Background

Gene References Into Functions
  1. Aberrant DNA methylation of the CMTM2 gene is associated with colorectal cancer. PMID: 22901147
  2. Intracellular CMTM2 negatively regulates HIV-1 transcription, at least partially, by targeting the AP-1 and CREB pathways. PMID: 21034562
  3. CKLFSF2, specifically expressed in meiotic and post-meiotic germ cells, localizes to the endoplasmic reticulum (ER) near the Golgi apparatus. PMID: 17334588
Database Links

HGNC: 19173

OMIM: 607885

KEGG: hsa:146225

STRING: 9606.ENSP00000268595

UniGene: Hs.195685

Protein Families
Chemokine-like factor family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in testis.

Q&A

What is CMTM2 and how is it structurally classified within the CMTM family?

CMTM2 belongs to the Chemokine-like factor (CKLF)–like MARVEL transmembrane domain-containing family (CMTMs), which consists of CKLF and CMTM1 to CMTM8. Structurally, CMTM2 has higher sequence identity with chemokines compared to other family members like CMTM8. All CMTM proteins contain a MARVEL domain with four transmembrane-helix architecture that is closely linked with vesicle transport and membrane binding events .

CMTM2 exists in both secreted and transmembrane isoforms, which is consistent with its dual functionality. This protein exhibits characteristics between classical chemokines and transmembrane 4 super family (TM4SF) members. Most CMTM transcripts have multiple alternative splicing forms, but all resulting protein products contain the MARVEL domain .

What physiological functions has CMTM2 been definitively associated with?

CMTM2 serves several crucial physiological functions:

  • Male reproduction: CMTM2 is essential for spermiogenesis in mice. Studies demonstrate it is highly expressed in male testes and plays a crucial role in spermatogenesis and testicular development .

  • Immune regulation: CMTM2 exhibits a negative regulatory effect on human immunodeficiency virus type-1 transcription by inhibiting the AP-1 and CREB pathways .

  • Skeletal muscle development: Research suggests that CMTM2 may promote the proliferation and survival of skeletal muscle cells, indicating its potential role in muscle growth .

  • Tumor suppression: CMTM2 demonstrates tumor suppressor functions in hepatocellular carcinoma by inhibiting proliferation, invasion, and metastasis .

What methodologies are recommended for effectively studying CMTM2 expression in clinical samples?

For robust CMTM2 detection in clinical samples, researchers should consider multiple complementary approaches:

  • Serum detection: ELISA assay is effective for measuring serum CMTM2 levels in patients. This method was successfully employed to detect significantly lower CMTM2 values in HBV-related disease patients compared to healthy controls .

  • Tissue expression analysis:

    • RT-PCR for measuring mRNA expression and identifying alternative splicing variants

    • Immunohistochemistry for protein localization in tissues

    • Western blot for quantitative protein expression analysis

  • Experimental controls: When designing studies, include appropriate positive and negative controls:

    • Healthy tissue/serum samples as baseline controls

    • Known high-expression tissues (e.g., testes) as positive controls

    • Appropriate isotype controls for antibody-based detection methods

How should researchers design experiments to investigate CMTM2's tumor suppressor function?

Based on published methodologies, a comprehensive experimental approach should include:

In vitro studies:

  • Expression manipulation models:

    • Knockdown CMTM2 using siRNA in hepatocellular carcinoma cell lines (e.g., Huh-7, SMMC7721, HepG2)

    • Establish CMTM2 overexpression models using appropriate vectors

    • Include negative control (SiNC) for comparison

  • Functional assays:

    • Proliferation: CCK-8 assays and colony formation assays

    • Migration and invasion: Wound healing and Transwell assays

    • Cell cycle analysis: Flow cytometry for cell cycle distribution and apoptosis

    • EMT marker analysis: Assess E-cadherin, vimentin, and other EMT markers

In vivo studies:

  • Xenograft tumor models in Balb/c nude mice using CMTM2-manipulated cells

  • Measure tumor growth, metastasis, and EMT marker expression

Experimental ApproachMeasurementsExpected Outcomes for Tumor Suppressor Function
CMTM2 knockdownCell proliferation, migration, invasionIncreased compared to control
CMTM2 overexpressionCell proliferation, migration, invasionDecreased compared to control
CMTM2 knockdownG2/M phase cell populationReduced G2/M phase accumulation
CMTM2 overexpressionG2/M phase cell populationIncreased G2/M phase accumulation
CMTM2 expressionE-cadherin levelsPositive correlation

The experimental design should follow rigorous statistical planning with appropriate sample sizes to ensure results are statistically significant and biologically relevant .

What are the molecular mechanisms underlying CMTM2 degradation in HBV-infected cells?

The degradation of CMTM2 in HBV-infected cells involves specific molecular mechanisms:

  • Ubiquitin-proteasome pathway: HBV infection suppresses CMTM2 expression by activating the ubiquitin-proteasome system. Specifically, CMTM2 degradation is attributed to HBx-activated Lys48 (K48)-linked polyubiquitination .

  • Proteasome inhibition: The degradation process can be abolished by treatment with the proteasome inhibitor MG132, confirming the involvement of proteasomal degradation rather than other protein degradation pathways .

  • HBx protein role: The HBV X protein (HBx) appears to be a key viral factor responsible for initiating the CMTM2 degradation process through activation of the ubiquitination machinery .

This degradation mechanism represents a specific viral strategy to overcome host defenses and promotes HBV-related disease progression. Further research should focus on identifying the specific E3 ubiquitin ligases involved and potential therapeutic strategies to prevent CMTM2 degradation.

How does CMTM2 regulate the epithelial-mesenchymal transition (EMT) process in hepatocellular carcinoma?

CMTM2 appears to play a crucial regulatory role in the EMT process in hepatocellular carcinoma:

  • Inverse relationship with EMT: Down-regulation of CMTM2 promotes the EMT process in HCC cells, suggesting CMTM2 functions as an EMT inhibitor .

  • E-cadherin correlation: Research has demonstrated a significant positive correlation between CMTM2 and E-cadherin (an epithelial marker) in HCC tissues. Pearson correlation tests showed a statistically significant positive correlation (P<0.05) .

  • Functional evidence: When CMTM2 expression was knocked down in Huh-7 and SMMC7721 cells, researchers observed:

    • Increased cell invasion and migration capabilities

    • Enhanced EMT markers expression pattern

    • Decreased E-cadherin expression

This regulatory relationship suggests that loss of CMTM2 in HCC tissues may be a significant contributor to metastasis through EMT induction, providing a potential therapeutic target for preventing HCC progression.

What is the potential diagnostic value of serum CMTM2 for HBV-related disorders based on ROC curve analysis?

ROC curve analysis reveals significant diagnostic potential for serum CMTM2 in distinguishing HBV-related disorders from healthy controls:

ComparisonAUC Value (95% CI)SensitivitySpecificityInterpretation
CHB vs Healthy Controls0.88 (0.82-0.94)75.36%95.23%Strong diagnostic value
HBLC vs Healthy Controls0.81 (0.74-0.88)68.83%88.46%Good diagnostic value
HCC vs Healthy Controls0.88 (0.81-0.95)86.79%88.46%Strong diagnostic value
HBLC/HCC vs CHB0.50 (0.42-0.59)53.08%63.77%No diagnostic value

These findings indicate that serum CMTM2 has strong potential as a biomarker for differentiating HBV-related disorders from healthy individuals. The high AUC values (>0.8) for distinguishing CHB, HBLC, and HCC from healthy controls suggest excellent discriminatory power .

How should researchers interpret contradictory findings about CMTM2's role across different cancer types?

When encountering contradictory findings about CMTM2's role in different cancer contexts, researchers should systematically analyze:

  • Tissue-specific effects: CMTM2 may function differently depending on the tissue context. For example, while CMTM2 appears to be a tumor suppressor in hepatocellular carcinoma , its role may differ in other cancer types.

  • Splice variant differences: Different studies may be examining different CMTM2 splice variants. Research has shown that CMTM2 has multiple alternative splicing forms that may have distinct functions. For example, CMTM1-v17 mRNA was reported to be high in liver cancer .

  • Methodological variations: Differences in experimental approaches, cell lines used, detection methods, and statistical analyses can contribute to seemingly contradictory results.

  • Statistical considerations: When analyzing CMTM2 expression patterns, researchers should employ comprehensive statistical approaches:

    • t-test for verifying expression differences (threshold P < 0.01)

    • Corrplot package (R) with Spearman's correlation for difference significance

    • Principal component analysis and unsupervised hierarchical clustering

    • Survival analysis using appropriate statistical packages

  • Sample size and population differences: Variations in study cohorts, including ethnicity, disease stage, and treatment history, may explain contradictory findings.

To reconcile contradictions, meta-analyses of multiple studies and multi-center validation studies with standardized protocols are recommended.

What are the promising research avenues for developing CMTM2-based therapeutic strategies?

Based on current understanding of CMTM2 function, several promising therapeutic strategies warrant investigation:

  • Restoring CMTM2 expression: Since CMTM2 demonstrates tumor suppressor functions in HCC, developing approaches to restore its expression could inhibit tumor growth and metastasis. Potential methods include:

    • Gene therapy approaches to deliver functional CMTM2

    • Small molecules that enhance endogenous CMTM2 expression

    • Targeting the ubiquitin-proteasome machinery that degrades CMTM2 in HBV-infected cells

  • Inhibiting EMT progression: Given CMTM2's role in suppressing EMT, therapeutic strategies could target this pathway:

    • Developing peptide mimetics of CMTM2's functional domains

    • Combination therapies targeting both CMTM2 and other EMT regulatory molecules

    • Screening for compounds that mimic CMTM2's effects on E-cadherin expression

  • HBV-specific interventions: Understanding how HBV suppresses CMTM2 opens opportunities for virus-specific therapies:

    • Targeting HBx-mediated CMTM2 degradation

    • Identifying and inhibiting specific E3 ligases involved in CMTM2 ubiquitination

    • Developing proteasome inhibitors with higher specificity for the CMTM2 degradation pathway

  • Diagnostic applications: Further validating serum CMTM2 as a biomarker for HBV-related disorders through larger multi-center studies .

What methodological advances would improve research on CMTM2 alternative splicing forms?

To better understand the functional diversity of CMTM2 splice variants, researchers should consider these methodological improvements:

  • Comprehensive splicing detection:

    • RNA-Seq with sufficient depth to detect all splice variants

    • Long-read sequencing technologies (PacBio, Nanopore) to accurately capture full-length transcripts

    • PCR-based approaches with primers designed to specifically amplify different splice variants

  • Splice variant-specific functional analysis:

    • CRISPR-Cas9 gene editing targeting specific exons

    • Splice variant-specific siRNAs for selective knockdown

    • Overexpression of individual splice variants to assess isoform-specific functions

  • Tissue-specific expression profiling:

    • Single-cell RNA sequencing to identify cell type-specific expression patterns

    • Spatial transcriptomics to map splice variant distribution within tissues

    • Developmental time course analyses to understand temporal regulation

  • Clinical correlation studies:

    • Associate specific splice variants with disease progression

    • Develop splice variant-specific antibodies for immunohistochemistry

    • Correlate splice variant expression with patient outcomes

  • Computational approaches:

    • Machine learning algorithms to predict functional consequences of alternative splicing

    • Structural modeling of protein isoforms to infer functional differences

    • Network analysis to identify splice variant-specific interaction partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.