Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 3 (CMTM3)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 3 (CMTM3), also known as chemokine-like factor superfamily 3 (CKLFSF3), is a protein encoded by the CMTM3 gene located on chromosome 16q22.1 in humans . It belongs to the CKLF-like MARVEL transmembrane domain-containing (CMTM) family, which includes eight members (CMTM1-8) and CKLF . CMTM proteins, including CMTM3, possess structural characteristics of chemokines and transmembrane 4 superfamily (TM4SF) proteins . They play significant roles in the immune system, male reproductive system, and tumorigenesis .

Tissue Expression

CMTM3 is expressed in a wide array of tissues, including fetal tissues, the immune system, and the male reproductive system . Specifically, it shows high expression in testicular tissues and circulating blood cells such as B lymphocytes, CD4+ T lymphocytes, and monocytes .

Role in Cancer

CMTM3's role in cancer is complex and varies depending on the type of cancer.

Functional and Pathway Enrichment Analysis

Functional and pathway enrichment analyses reveal potential roles of CMTM3 in various biological processes. CMTM3 is enriched in:

  • Regulation of cell proliferation

  • Regulation of cell differentiation

  • Cell morphogenesis

  • Hedgehog signaling pathway

  • Wnt signaling pathway

  • ECM-receptor interaction

  • Pathways in cancer

Impact on Immune Response

CMTM family members can activate and chemoattract immune cells, influencing tumor cell proliferation and invasion . CMTM3 is correlated with macrophages, dendritic cells, and CD4+ T cells . CMTM3 regulates neutrophil migration and affects TLR4 expression, which influences the release and retention of bone marrow neutrophils in sepsis .

Clinical Significance

CMTM3 has potential as a prognostic marker and therapeutic target in various cancers.

  • Prognostic Value: CMTM3 expression levels can predict survival outcomes in glioma and pancreatic cancer . High CMTM3 expression often correlates with unfavorable clinical characteristics and poor survival .

  • Therapeutic Target: CMTM3 may serve as a potential molecular target in the prevention and/or treatment of HCC invasion and metastasis .

CMTM Family Overview

The CMTM family consists of eight members (CMTM1-8) and CKLF, sharing similarities with the chemokine family and the transmembrane 4 superfamily (TM4SF) . These proteins contain a structurally conserved MARVEL domain and play roles in growth factor receptor activation, cell proliferation, apoptosis, metastasis, and immune evasion .

CMTM3 and Cell Adhesion

CMTM3 mediates cell-cell adhesion at adherens junctions and contributes to the control of vascular sprouting by regulating VE-cadherin turnover .

Tables

FeatureDescription
Gene NameCMTM3 (CKLF-like MARVEL transmembrane domain-containing protein 3)
Chromosomal Location16q22.1
Protein FamilyCKLF-like MARVEL transmembrane domain-containing (CMTM) family
ExpressionWide range of tissues, including fetal tissues, male reproductive system, and immune system
Role in CancerVaries depending on cancer type; can promote or inhibit tumor progression
Biological ProcessesRegulation of cell proliferation, cell differentiation, cell morphogenesis, immune response, cell-cell adhesion
Potential Clinical ValuePrognostic marker and therapeutic target in various cancers

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CMTM3; CKLFSF3; CKLF-like MARVEL transmembrane domain-containing protein 3; Chemokine-like factor superfamily member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CMTM3
Target Protein Sequence
MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYV ASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFAISITA IAKYSDGASKAAGVFGFFATIVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEENSDSD SD
Uniprot No.

Target Background

Gene References Into Functions

CMTM3 Function and Clinical Significance:

  1. Reduced CMTM3 expression is observed in gastric cancer, with miR-135b-5p promoting cancer progression by targeting CMTM3. (PMID: 29345297)
  2. CMTM3 knockdown enhances gastric cancer metastasis via the STAT3/Twist1/EMT pathway. (PMID: 27121055)
  3. CMTM3 hypermethylation is significantly higher in colorectal cancer tissues compared to adjacent normal tissues. (PMID: 28782576)
  4. CMTM3 downregulates EGFR expression, promotes its degradation, and inhibits EGF-mediated gastric cancer tumorigenicity by enhancing Rab5 activity. (PMID: 27867015)
  5. CMTM3 mediates cell-cell adhesion at adherens junctions and regulates vascular sprouting by controlling VE-cadherin turnover. (PMID: 28428220)
  6. CMTM3 overexpression suppresses hepatocellular carcinoma tumor growth. (PMID: 27629543)
  7. CMTM3 is identified as a novel secretory protein released via exosomes in the prostate. (PMID: 27125975)
  8. Increased CMTM3 methylation is a risk factor in male laryngeal squamous cell carcinoma (LSCC), particularly in patients over 55 years old and smokers. (PMID: 27521994)
  9. Reduced CMTM3 expression is associated with prostate cancer. (PMID: 25990505)
  10. Low CMTM3 expression correlates with metastasis and recurrence in oral squamous cell carcinoma. (PMID: 25946973)
  11. CMTM3 is significantly downregulated in clear cell renal cell carcinoma and exhibits tumor-suppressive functions. (PMID: 23907292)
  12. CMTM3 suppresses peritoneal disseminated metastases. (PMID: 24131472)
  13. CMTM3/CKLFSF3 is an evolutionarily conserved gene with potential roles in the male reproductive and immune systems. (PMID: 17002874)
  14. CMTM3 inhibits prostate-specific antigen expression at both the mRNA and protein levels without significantly affecting androgen receptor expression. (PMID: 18402773)
Database Links

HGNC: 19174

OMIM: 607886

KEGG: hsa:123920

STRING: 9606.ENSP00000354579

UniGene: Hs.298198

Protein Families
Chemokine-like factor family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the leukocytes, placenta and testis.

Q&A

What is CMTM3 and what cellular functions does it serve?

CMTM3 (CKLF-like MARVEL transmembrane domain-containing protein 3) is a transmembrane protein that is differentially expressed across various tissues and has been implicated in multiple cellular functions. Research shows CMTM3 is involved in tumor occurrence and progression, with significant expression differences between normal and malignant tissues . CMTM3 appears to play crucial roles in immune regulation and is associated with various immune cell populations in the tumor microenvironment, including cancer-associated fibroblasts, macrophages, myeloid dendritic cells, and endothelial cells .

How is CMTM3 expression regulated in normal tissue versus tumor tissue?

CMTM3 expression varies significantly between normal tissues and tumor tissues. Analysis from the TCGA and GTEx databases reveals that CMTM3's expression is increased in 21 tumor types including glioblastoma (GBM), low-grade glioma (LGG), breast cancer (BRCA), and sarcoma (SARC) . Specifically in glioma, CMTM3 expression is significantly elevated compared to normal brain tissue . The regulatory mechanisms controlling this differential expression remain an active area of investigation, though correlations with specific genetic alterations like IDH mutation status and 1p/19q codeletion in gliomas have been observed .

What databases and resources are available for CMTM3 expression and function analysis?

Researchers can access CMTM3 expression data through several comprehensive databases:

  • The Cancer Genome Atlas (TCGA): Contains RNAseq data across multiple tumor types

  • Genotype-Tissue Expression (GTEx): Provides expression data from normal tissues

  • UCSC Xena database: Offers cancer genome mapping data

  • ImmuCellAI database: Contains immune cell infiltration scores

  • TIMER2 database: Provides tumor immune estimation resources

These resources allow for comparative analysis of CMTM3 expression across tissues, correlation with clinical outcomes, and assessment of relationships with immune cells and other molecular features .

How does CMTM3 expression correlate with specific genetic alterations in glioma?

CMTM3 expression in glioma demonstrates significant correlations with key genetic alterations that impact prognosis. Research indicates that CMTM3 expression is significantly higher in IDH wild-type gliomas compared to IDH mutant gliomas . Similarly, patients with 1p/19q non-codeletion glioma exhibit significantly higher CMTM3 expression than those with 1p/19q codeletion . These correlations are clinically meaningful as IDH wild-type and 1p/19q non-codeletion status are both associated with poorer prognosis in glioma patients. The mechanistic relationship between these genetic alterations and CMTM3 expression remains to be fully elucidated but suggests potential regulatory pathways that could be targeted therapeutically.

What molecular pathways is CMTM3 involved in within the tumor microenvironment?

Gene Set Enrichment Analysis (GSEA) across 33 tumor types from the TCGA database suggests CMTM3 is primarily involved in pathways related to immune functions . CMTM3 expression correlates significantly with immune activation genes, immune suppression genes, immune checkpoints, chemokines, and their receptors . These associations suggest CMTM3 may function as an immunomodulatory molecule within the tumor microenvironment. Specifically, CMTM3 expression correlates with the infiltration of cancer-associated fibroblasts, macrophages, myeloid dendritic cells, and endothelial cells, which are critical components of the tumor microenvironment that influence tumor progression and therapeutic response .

How does CMTM3 contribute to immunosuppression in the tumor microenvironment?

CMTM3 appears to function as an "oncogene" in most tumors by potentially modulating the protumor immune microenvironment to facilitate immune escape . Analysis reveals CMTM3 expression is directly connected to most immune activation genes, genes related to immune suppression, chemokine receptor genes, and chemokine genes—all key elements of the tumor microenvironment . The interaction between CMTM3-expressing tumor cells with immune cells and surrounding tissues creates a complex integrated microenvironmental system that enhances tumor cell proliferation, migration, and immune evasion. Evidence suggests CMTM3 may work in conjunction with other immune checkpoints to alter the immune milieu, potentially functioning as a novel immune checkpoint regulator .

How effective is CMTM3 as a prognostic biomarker in different cancer types?

The following table summarizes CMTM3's prognostic significance across different cancer types based on univariate Cox regression analysis:

What is the specific prognostic value of CMTM3 in glioma subtypes?

  • WHO grade III gliomas: Patients with high CMTM3 expression had significantly lower OS compared to those with low expression

  • IDH wild-type gliomas: Higher CMTM3 expression correlated with lower OS

  • 1p/19q non-codeletion gliomas: The OS rate was lower in the high CMTM3 expression group

  • Patients older than 40 years: Significant prognostic differences were observed between high and low CMTM3 expression groups

These findings suggest CMTM3 could serve as a valuable molecular marker for risk stratification in glioma patients, helping to guide treatment decisions across different molecular and clinical subtypes.

How does CMTM3 compare to established prognostic markers in cancer research?

CMTM3 offers several advantages over many existing prognostic markers. Unlike many prognostic biomarkers that function solely as indicators without therapeutic relevance, CMTM3 combines prognostic value with potential as an immunotherapeutic target due to its strong correlation with immune cells and the tumor microenvironment . This dual functionality increases its translational potential in clinical settings.

When evaluated in glioma, CMTM3 demonstrated strong prediction capability for 1-year and 3-year survival outcomes (AUC values of 0.821 and 0.750) . These values suggest CMTM3 may offer comparable or superior prognostic accuracy to some established markers. Additionally, CMTM3's prognostic significance extends across multiple cancer types, indicating broader utility than some tissue-specific markers .

What are the recommended methods for analyzing CMTM3 expression in clinical samples?

For comprehensive analysis of CMTM3 expression in clinical samples, researchers should consider implementing a multi-modal approach:

These methodological approaches allow for comprehensive characterization of CMTM3's expression patterns and functional significance in clinical samples.

How can researchers effectively investigate the functional role of CMTM3 in immune regulation?

To investigate CMTM3's role in immune regulation, researchers should implement the following methodological approaches:

  • Correlation Analysis with Immune Cell Markers: Examine correlations between CMTM3 expression and established markers for various immune cell populations. Tools like TIMER2 and ImmuCellAI databases provide immune cell infiltration scores that can be analyzed against CMTM3 expression levels .

  • Co-expression Analysis: Analyze CMTM3's co-expression patterns with:

    • Immune activation genes

    • Immune suppression genes

    • Immune checkpoint molecules

    • Chemokines and their receptors
      This provides insights into CMTM3's role within immune regulatory networks .

  • In vitro Co-culture Systems: Establish co-culture systems with CMTM3-expressing tumor cells and various immune cell populations to assess functional interactions and effects on immune cell activation, suppression, or polarization.

  • Gene Manipulation Studies: Implement CMTM3 knockdown or overexpression experiments in tumor models to evaluate resulting changes in immune infiltration and activation status.

  • Immune Checkpoint Blockade Combination Studies: Investigate whether modulating CMTM3 expression or function affects response to established immune checkpoint inhibitors, which would support its role as a potential immune checkpoint regulator .

These methodological approaches would provide comprehensive insights into CMTM3's functional role in immune regulation within the tumor microenvironment.

What evidence supports CMTM3 as a potential immune checkpoint regulator?

Multiple lines of evidence suggest CMTM3 may function as a novel immune checkpoint regulator:

  • Correlation with Established Immune Checkpoints: CMTM3 expression shows significant positive correlations with known immune checkpoint molecules across multiple cancer types, suggesting it may operate within similar regulatory networks .

  • Association with Immunosuppressive Cells: CMTM3 expression correlates strongly with infiltration of cells that typically create immunosuppressive environments, including cancer-associated fibroblasts and certain macrophage populations .

  • Direct Connection to Immune Regulatory Genes: Analysis reveals CMTM3 is directly connected to both immune activation genes and genes related to immune suppression status, indicating a potential role in balancing immune responses .

  • Impact on Tumor Microenvironment: Increased CMTM3 expression appears to create conditions that help tumors achieve immune escape, similar to the function of established immune checkpoints .

  • Prognostic Significance: Like many immune checkpoint molecules, CMTM3 expression is associated with patient outcomes in multiple cancer types, with high expression generally correlating with poorer prognosis .

These findings collectively support further investigation of CMTM3 as a potential immune checkpoint regulator that could be targeted for cancer immunotherapy.

How might CMTM3-targeted therapies be developed and what challenges might arise?

Development of CMTM3-targeted therapies represents a promising but challenging research direction, with several key considerations:

  • Therapeutic Approaches:

    • Monoclonal antibodies against CMTM3 to block its interaction with receptors/ligands

    • Small molecule inhibitors targeting CMTM3-mediated signaling pathways

    • Gene therapy approaches to downregulate CMTM3 expression in tumors

    • Combination approaches with established immune checkpoint inhibitors

  • Challenges and Considerations:

    • Target Validation: Further research is needed to definitively establish CMTM3's mechanism of action in immune regulation

    • Expression in Normal Tissues: Understanding CMTM3's role in normal tissues is essential to predict potential toxicities

    • Patient Selection: Identifying biomarkers to select patients likely to respond to CMTM3-targeted therapy

    • Resistance Mechanisms: Anticipating potential compensatory mechanisms that might lead to resistance

  • Combination Strategies:
    Since CMTM3 works in conjunction with other immune checkpoints, combination approaches targeting multiple checkpoints simultaneously might yield synergistic effects . Understanding the optimal timing and sequencing of such combinations would be critical.

  • Translational Considerations:
    Development of reliable assays to measure CMTM3 expression or activity in clinical samples would be essential for patient selection and response monitoring.

Given CMTM3's connection to various aspects of the tumor immune microenvironment, successful targeting could potentially modulate multiple components simultaneously, offering advantages over more narrowly focused immunotherapies.

What are the key unanswered questions regarding CMTM3 structure and function?

Despite growing evidence for CMTM3's importance in cancer biology, several fundamental questions remain unanswered:

  • Structural Biology: The three-dimensional structure of CMTM3 has not been fully characterized. Understanding its structural domains and how they interact with binding partners would facilitate rational drug design.

  • Signaling Mechanisms: The precise molecular pathways through which CMTM3 influences immune cell function and tumor progression require further elucidation. While correlations with immune cells are established, the direct signaling mechanisms remain unclear .

  • Binding Partners: The ligands, receptors, or other interacting partners of CMTM3 that mediate its biological effects have not been definitively identified. Discovering these interaction partners would be crucial for understanding CMTM3's function.

  • Isoform-Specific Functions: Investigation into whether different CMTM3 isoforms might have distinct biological functions in normal versus malignant tissues.

  • Epigenetic Regulation: The mechanisms controlling CMTM3 expression across different tissues and disease states, including potential epigenetic regulation, need further investigation.

Addressing these fundamental questions would significantly advance our understanding of CMTM3 biology and accelerate therapeutic development efforts.

How might research into CMTM3 impact our understanding of cancer immunology more broadly?

Research into CMTM3 has the potential to advance cancer immunology in several significant ways:

  • Novel Immune Regulatory Pathways: CMTM3 investigation may uncover previously unrecognized immune regulatory pathways, expanding our understanding of how tumors evade immune recognition and elimination .

  • Tumor Microenvironment Dynamics: CMTM3's association with multiple cell types in the tumor microenvironment provides opportunities to better understand the complex cross-talk between tumor cells, immune cells, and stromal components .

  • Biomarker Development: Integration of CMTM3 with other prognostic markers may lead to more accurate predictive models for immunotherapy response, helping address the challenge of patient selection .

  • Resistance Mechanisms: Studying CMTM3 in the context of immunotherapy resistance could illuminate mechanisms by which tumors adapt to evade immune-based treatments.

  • Immunotherapy Combinations: Understanding CMTM3's relationship with established immune checkpoints could inform rational design of combination immunotherapy approaches that might overcome current limitations of single-agent treatments .

By pursuing these research directions, investigation of CMTM3 could substantially impact our conceptual framework for cancer immunology and lead to tangible advances in cancer treatment.

How does CMTM3 integrate with other molecular features to influence cancer progression?

CMTM3 appears to function within a complex network of molecular interactions that collectively drive cancer progression. Current research indicates several key integration points:

  • Genetic Alterations: In glioma, CMTM3 expression shows significant associations with IDH mutation status and 1p/19q codeletion status, suggesting integration with fundamental genetic drivers of tumor biology .

  • Tumor Microenvironment: CMTM3 expression correlates with infiltration of cancer-associated fibroblasts, macrophages, myeloid dendritic cells, and endothelial cells—suggesting it may coordinate interactions between tumor cells and their microenvironment .

  • Immune Checkpoint Network: CMTM3 shows direct connections to immune activation genes, immune suppression genes, and established immune checkpoints, indicating it functions within a larger immunoregulatory network rather than in isolation .

  • Chemokine Signaling: Analysis reveals strong correlations between CMTM3 and various chemokines and their receptors, suggesting a role in regulating immune cell trafficking within the tumor microenvironment .

These integration points demonstrate that CMTM3 likely functions as a nodal point connecting genetic alterations, immune regulation, and microenvironmental factors in cancer progression.

What methodological challenges exist in studying CMTM3 across different experimental systems?

Researchers face several significant methodological challenges when studying CMTM3 across different experimental systems:

  • Model System Variability: Expression and function of CMTM3 may vary substantially between in vitro cell lines, animal models, and human tissues, necessitating careful validation across multiple systems.

  • Context Dependency: CMTM3's role appears to be highly context-dependent, with different effects observed across cancer types and even within subtypes of the same cancer . This requires careful selection and characterization of model systems.

  • Immune Component Representation: Many traditional cancer models poorly recapitulate the complex immune environment in which CMTM3 appears to function. Humanized mouse models or complex organoid systems may be needed to fully assess CMTM3's immunomodulatory roles.

  • Temporal Dynamics: CMTM3's influence may change throughout cancer progression or treatment, requiring longitudinal analyses rather than single timepoint assessments.

  • Technical Detection Challenges: Reliable detection of CMTM3 protein (versus mRNA) across different tissue types may present technical hurdles that need to be addressed for consistent analysis.

Addressing these methodological challenges will be essential for generating reliable and translatable findings regarding CMTM3's role in cancer biology.

How can CMTM3 research be translated into clinical applications for patient stratification?

CMTM3 research shows significant potential for clinical translation in patient stratification:

  • Prognostic Classification: CMTM3 expression level could be incorporated into multi-marker prognostic panels to better stratify patients by risk. In low-grade glioma, CMTM3 has already demonstrated strong predictive value with AUC values of 0.821 and 0.750 for 1-year and 3-year survival, respectively .

  • Treatment Selection Biomarker: Given CMTM3's associations with immune regulation, its expression profile might predict response to immunotherapies, helping identify patients most likely to benefit from these treatments .

  • Molecular Subtyping: Integration of CMTM3 expression with other molecular features could refine cancer subtyping beyond traditional histological classification, particularly in gliomas where CMTM3 correlates with established molecular markers like IDH mutation and 1p/19q codeletion status .

  • Monitoring Tool: Changes in CMTM3 expression during treatment might serve as a pharmacodynamic biomarker to assess treatment efficacy.

  • Combination Therapy Guidance: CMTM3 expression patterns could inform rational design of combination immunotherapy approaches, potentially identifying patients who would benefit from novel combinations targeting both CMTM3 and other immune checkpoints .

Implementing these applications would require standardization of CMTM3 detection methods and prospective validation in clinical trials before widespread adoption.

What are the practical considerations for developing CMTM3 as a clinical biomarker?

Developing CMTM3 as a clinical biomarker requires addressing several practical considerations:

  • Analytical Validation:

    • Standardization of detection methods (IHC, RNA-seq, qPCR) across laboratories

    • Establishment of clear cutoff values to define "high" versus "low" expression

    • Quality control measures to ensure reproducibility

  • Clinical Validation:

    • Prospective studies to confirm prognostic value in independent patient cohorts

    • Comparison with standard-of-care prognostic markers

    • Assessment in the context of current treatment paradigms

  • Sample Requirements:

    • Determination of optimal sample types (fresh frozen vs. FFPE)

    • Stability of CMTM3 detection in archived samples

    • Minimum sample requirements for reliable assessment

  • Implementation Considerations:

    • Integration into existing molecular testing workflows

    • Cost-effectiveness analysis to justify clinical adoption

    • Development of clinician education materials to guide interpretation

  • Regulatory Pathway:

    • Clear definition of the intended use (prognostic, predictive, or both)

    • Collection of necessary validation data for regulatory submissions

    • Consideration of companion diagnostic development if linked to specific therapies

Addressing these practical considerations systematically would facilitate the translation of CMTM3 from a research biomarker to a clinically useful tool for cancer management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.