Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 6 (CMTM6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CMTM6; CKLFSF6; CKLF-like MARVEL transmembrane domain-containing protein 6; Chemokine-like factor superfamily member 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CMTM6
Target Protein Sequence
MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVS QCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLA SIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEP LNA
Uniprot No.

Target Background

Function

CMTM6 is a master regulator of the recycling and plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand crucial for self-tolerance and antitumor immunity. It interacts with both constitutive and interferon-γ (IFNG)-induced PD-L1/CD274 at recycling endosomes, protecting PD-L1/CD274 from lysosomal degradation, potentially by preventing STUB1-mediated ubiquitination. CMTM6 stabilizes PD-L1/CD274 expression on antigen-presenting cells and enhances inhibitory signaling by PDCD1/CD279 (its receptor on T cells), ultimately inducing T-cell anergy.

Gene References Into Functions
  1. CMTM6, located on the cell surface, associates with PD-L1, reducing its ubiquitination and extending its half-life. This enhances the ability of PD-L1-expressing tumor cells to inhibit T cells. These findings indicate that PD-L1 relies on CMTM6/4 for optimal inhibitory function, suggesting potential therapeutic targets to block this pathway. PMID: 28813410
  2. CMTM6 depletion, by reducing PD-L1, significantly alleviates the suppression of tumor-specific T cell activity in vitro and in vivo. This research provides insights into PD-L1 regulation, identifies CMTM6 as a previously unknown master regulator of this critical immune checkpoint, and highlights its potential as a therapeutic target to overcome tumor immune evasion. PMID: 28813417
  3. Bioinformatic analysis of CKLF2 cDNA and protein sequences, combined with experimental validation, identified the CKLFSF1-8 gene cluster between the SCY and TM4SF gene families. The eight family members were cloned and characterized. PMID: 12782130
Database Links

HGNC: 19177

OMIM: 607889

KEGG: hsa:54918

STRING: 9606.ENSP00000205636

UniGene: Hs.380627

Protein Families
Chemokine-like factor family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the leukocytes, placenta and testis.

Q&A

What experimental approaches are most effective for detecting CMTM6 expression in tumor samples?

Immunohistochemical (IHC) staining remains the gold standard for CMTM6 detection in clinical specimens. For optimal results, researchers should consider:

  • Antibody selection: Use validated antibodies with demonstrated specificity for CMTM6

  • Sample preparation: Formalin-fixed paraffin-embedded (FFPE) sections at 4-5μm thickness

  • Scoring systems: Implement semi-quantitative scoring based on staining intensity (0-3+) and percentage of positive cells

  • Double staining protocols: For co-localization studies with PD-L1 or other proteins

Immunohistochemical double staining has revealed that CMTM6 and PD-L1 are co-expressed on hepatocellular carcinoma cells, although with different expression patterns. CMTM6 typically shows diffuse expression while PD-L1 exhibits more localized or heterogeneous patterns in tumor tissues .

For quantitative assessment, Western blotting with densitometric analysis provides reliable protein quantification, while RT-qPCR allows measurement of mRNA expression levels.

How does CMTM6 expression vary across different cancer types, and what methodologies should be used to study this variation?

CMTM6 expression varies significantly across cancer types, necessitating careful methodological approaches:

Cancer TypeCMTM6 Expression PatternCorrelation with OutcomesMethodological Considerations
Colorectal CancerOften upregulatedPoor survivalRequires comparison with normal mucosa
Hepatocellular Carcinoma25.1% high expression (n=65/259)Poor differentiation, intrahepatic metastasisScore using both intensity and percentage
Pancreatic AdenocarcinomaIncreased expressionNot fully establishedCompare with normal pancreatic tissue
GliomaIncreased expressionPoor prognosisSpecial consideration for blood-brain barrier
Head and Neck Squamous Cell CarcinomaIncreased expressionLinked to EMT phenotypesAssess alongside stemness markers

Methodologically, researchers should:

  • Use tissue microarrays for high-throughput screening

  • Implement multi-site tumor sampling to account for heterogeneity

  • Compare with paired normal tissues when available

  • Correlate with clinicopathological parameters

In hepatocellular carcinoma, high CMTM6 expression (25.1% of cases) was significantly associated with malignant features including poor differentiation (P < 0.0001), microscopic intrahepatic metastasis (P = 0.0369), and multiple intrahepatic recurrences (P = 0.0211) .

How does CMTM6 regulate PD-L1 stability, and what experimental designs best demonstrate this relationship?

CMTM6 regulates PD-L1 stability through protection from lysosomal degradation. To investigate this relationship:

  • Time-course experiments: Stimulate cells with IFN-γ and monitor PD-L1 expression over time (24-72 hours) in CMTM6-expressing versus CMTM6-knockdown cells

  • Lysosomal inhibition studies: Treat cells with lysosomal inhibitors (e.g., bafilomycin A1, chloroquine) to assess PD-L1 accumulation

  • Co-immunoprecipitation: Determine direct protein-protein interactions between CMTM6 and PD-L1

  • Cycloheximide chase assays: Measure PD-L1 protein half-life in the presence or absence of CMTM6

In HCC cell lines, researchers demonstrated that while PD-L1 was detectable at early time points after IFN-γ stimulation regardless of CMTM6 status, by 72 hours PD-L1 levels were significantly reduced in CMTM6-knockdown cells compared to control cells. Conversely, CMTM6 overexpression in low-expressing Hep3B cells enhanced PD-L1 expression maintenance .

Subcellular fractionation and immunofluorescence microscopy have demonstrated that CMTM6 colocalizes with PD-L1 primarily at the plasma membrane and in endosomal compartments.

What is the significance of CMTM6 expression in immune cells, and how should researchers approach studying this aspect?

CMTM6 is not limited to tumor cells but is widely expressed in immune cells, adding complexity to its role in cancer immunology:

  • Flow cytometry panel design: Include markers for major immune populations alongside CMTM6

  • Single-cell RNA sequencing: Map CMTM6 expression across immune subpopulations

  • Immune cell isolation protocols: Employ magnetic or fluorescence-activated cell sorting for functional studies

  • Conditional knockout models: Generate lineage-specific CMTM6 knockout mice

Research has shown that T-cell CMTM6 levels increase with sustained immune activation and intratumoral immune exhaustion, affecting T cell-intrinsic PD-L1 levels. Host CMTM6 knockout significantly restrains tumor growth in a manner dependent on CD8+ T cells, but interestingly, this effect is not entirely dependent on PD-L1 .

To investigate both tumor and host CMTM6 contributions:

  • Use bone marrow chimeras to distinguish immune versus non-immune host components

  • Implement cell-specific gene editing approaches

  • Design co-culture experiments with varying CMTM6 status in different cell populations

What methods should researchers use to investigate CMTM6's role in the Warburg effect and glucose metabolism?

CMTM6 plays a crucial role in the Warburg effect by regulating glucose transporter trafficking. To study this:

  • Glucose uptake assays: Measure 2-NBDG or 3H-2-deoxyglucose uptake in CMTM6-modified cells

  • Glycolytic flux analysis: Use a Seahorse XF analyzer to measure extracellular acidification rate (ECAR)

  • Lactate production measurement: Quantify lactate in culture media as an indicator of aerobic glycolysis

  • Glut1 trafficking studies: Track Glut1 localization using fluorescence microscopy and surface biotinylation

Mechanistic studies have revealed that CMTM6 forms a complex with Glut1 and Rab11 in endosomes of colorectal cancer cells. This complex is essential for Rab11-dependent transport of Glut1 to the plasma membrane and for protecting Glut1 from lysosomal degradation .

To confirm CMTM6's direct role in Glut1 trafficking:

  • Implement proximity ligation assays to demonstrate physical interaction

  • Perform pulse-chase experiments to track Glut1 movement in cells

  • Use dominant-negative Rab11 constructs to block trafficking pathways

CMTM6 knockdown leads to decreased glucose uptake and glycolysis in human and murine colorectal cancer cells, as Glut1 undergoes lysosomal degradation in the absence of CMTM6-mediated protection .

How does CMTM6 contribute to epithelial-to-mesenchymal transition (EMT) and stemness in cancer cells?

CMTM6 promotes EMT and stemness independently of its PD-L1 regulatory function. Recommended experimental approaches include:

  • EMT marker panels: Assess E-cadherin, N-cadherin, vimentin, Snail, Slug, and ZEB1/2 expression

  • Invasion and migration assays: Transwell and scratch wound healing tests with CMTM6-modified cells

  • Stemness assays: Sphere formation, ALDH activity, and stemness marker (SOX2, OCT4, NANOG) expression

  • Colony formation assays: Measure clonogenic potential as an indicator of stemness

In vitro studies with hepatocellular carcinoma cell lines demonstrated that CMTM6 knockdown significantly inhibited cell motility in both Huh7 and Hep3B cells. Conversely, CMTM6 overexpression significantly promoted cell motility and stemness capabilities in these cell lines .

For mechanistic insights, researchers should consider:

  • ChIP-seq to identify CMTM6-dependent transcriptional programs

  • RNA-seq to map global transcriptomic changes following CMTM6 modulation

  • Pathway inhibition studies to identify signaling cascades mediated by CMTM6

What are the optimal methods for investigating CMTM6's role in cancer metastasis?

CMTM6 has been implicated in promoting metastasis, particularly liver metastasis of colorectal cancer. Research approaches should include:

  • In vivo metastasis models:

    • Splenic injection for liver metastasis

    • Tail vein injection for lung metastasis

    • Orthotopic implantation with spontaneous metastasis tracking

  • Ex vivo organ culture systems:

    • 3D organotypic liver culture with tumor cell invasion tracking

    • Precision-cut tissue slices to study tumor-stroma interactions

  • Metastatic niche assessment:

    • Analyze secretome of CMTM6-expressing versus CMTM6-depleted cells

    • Perform multiplex immunofluorescence of metastatic tissues

    • Study cancer-associated fibroblast recruitment and activation

Multiomics revealed global transcriptomic changes in CMTM6-knockdown colorectal cancer cells that affected the transcriptomes of adjacent cancer-associated fibroblasts from liver metastases. CMTM6 knockdown led to reduced secretion of 60 cytokines/chemokines and inability to recruit cancer-associated fibroblasts that support an immunosuppressive liver metastasis microenvironment .

What approaches can researchers use to target CMTM6 for cancer therapy development?

Several approaches to targeting CMTM6 have shown promise in preclinical models:

  • Genetic targeting strategies:

    • shRNA-mediated knockdown effectively inhibited colorectal cancer tumor growth in immunocompromised mice

    • CRISPR-Cas9 knockout systems for complete protein elimination

    • Adeno-associated virus (AAV) delivery of CMTM6-targeting constructs

  • Pharmacological approaches:

    • Small molecule inhibitors targeting CMTM6-protein interactions

    • Peptide-based disruptors of CMTM6-PD-L1 or CMTM6-Glut1 complexes

    • Proteolysis-targeting chimeras (PROTACs) to induce CMTM6 degradation

  • Combination strategies:

    • CMTM6 suppression breaks resistance to immune checkpoint inhibitors

    • Can be combined with various antitumor drugs for enhanced efficacy

Researchers have developed and evaluated CMTM6-targeting adeno-associated virus (AAV) therapy, which effectively mobilized antitumor immunity and showed promising combinatorial effects with other anticancer agents .

How can researchers differentiate between PD-L1-dependent and PD-L1-independent effects of CMTM6 targeted therapies?

This sophisticated question requires carefully designed experimental approaches:

  • Genetic models:

    • Generate PD-L1 knockout cells with CMTM6 manipulation

    • Use PD-1 or PD-L1 knockout mice with CMTM6 targeting

    • Implement inducible expression systems for temporal control

  • Antibody blocking studies:

    • Compare anti-PD-1/PD-L1 alone versus combined with CMTM6 targeting

    • Employ isotype controls to confirm specificity

  • Downstream pathway analysis:

    • Map signaling cascades activated by CMTM6 independent of PD-L1

    • Perform phosphoproteomic analysis with pathway inhibitors

Research has shown that even without the PD-1/PD-L1 axis, CMTM6 suppression significantly dampened tumor growth in a manner dependent on cytotoxic cells. Host CMTM6 knockout significantly restrains tumor growth in a manner dependent on CD8+ T cells but not entirely dependent on PD-L1 .

How should CMTM6 and PD-L1 co-expression be evaluated for patient stratification in clinical studies?

For effective patient stratification in clinical studies:

  • Standardized scoring methodology:

    • Implement consistent cutoffs for "high" versus "low" CMTM6 expression

    • Use continuous scales rather than binary classification when possible

    • Consider combined scoring algorithms for CMTM6 and PD-L1

  • Patient grouping approaches:

    • Stratify patients into defined groups (e.g., high CMTM6/PD-L1 positive, high CMTM6/PD-L1 negative, low CMTM6)

    • Track clinical outcomes across these groups

  • Statistical considerations:

    • Perform multivariate analysis to account for confounding factors

    • Use time-dependent ROC analysis to identify optimal cutpoints

    • Implement propensity score matching for retrospective analyses

In a cohort of 259 hepatocellular carcinoma patients, researchers classified patients into three groups:

  • High CMTM6/PD-L1 positive (n=21)

  • High CMTM6/PD-L1 negative (n=44)

  • Low CMTM6 (n=194)

What methodological approaches are required to validate CMTM6 as a predictive biomarker for immune checkpoint inhibitor therapy?

Validating CMTM6 as a predictive biomarker requires rigorous methodology:

  • Retrospective analysis:

    • Analyze archival samples from immunotherapy clinical trials

    • Compare response rates and survival outcomes by CMTM6 status

    • Perform receiver operating characteristic analysis to establish predictive thresholds

  • Prospective validation:

    • Design biomarker-focused clinical trials with predefined CMTM6 cutoffs

    • Implement adaptive trial designs to refine biomarker criteria

    • Collect longitudinal samples to assess dynamic changes

  • Technical validation:

    • Establish assay reproducibility across laboratories

    • Compare different detection platforms (IHC, mRNA, protein)

    • Develop standardized reagents and protocols

Recent studies have shown that PD-1-inhibitor responder patients with non-small cell lung cancer had higher CMTM6 expression, which was found to be an independent predictor of response to PD-1 inhibitors. Therefore, evaluation of CMTM6 could be valuable for patient selection in immune checkpoint inhibitor therapy for various cancer types, including hepatocellular carcinoma .

How can researchers investigate the role of CMTM6 in modulating the tumor secretome and microenvironment?

Investigating CMTM6's impact on the tumor secretome requires sophisticated methodological approaches:

  • Secretome analysis:

    • Conduct mass spectrometry-based proteomics of conditioned media

    • Perform multiplex cytokine/chemokine profiling (Luminex, MSD platforms)

    • Use stable isotope labeling approaches (SILAC) for quantitative comparisons

  • Functional validation:

    • Test conditioned media effects on immune cell migration/activation

    • Perform 3D co-culture systems with stromal and immune components

    • Utilize transwell migration assays with fibroblasts or immune cells

  • In vivo microenvironment analysis:

    • Implement spatial transcriptomics/proteomics of tumor sections

    • Use intravital microscopy to track real-time interactions

    • Analyze single-cell suspensions by CyTOF or single-cell RNA-seq

Studies have shown that CMTM6 knockdown in colorectal cancer cells led to reduced secretion of 60 cytokines/chemokines and an inability to recruit cancer-associated fibroblasts that support an immunosuppressive metastatic microenvironment .

What experimental designs best address the potential interplay between CMTM6 and CMTM4 in cancer biology?

The functional relationship between CMTM6 and CMTM4 represents an advanced research question requiring specialized approaches:

  • Co-expression analysis:

    • Perform double immunostaining for CMTM6 and CMTM4

    • Quantify co-expression patterns in patient samples

    • Analyze public databases for correlation patterns

  • Functional redundancy testing:

    • Generate single and double knockouts/knockdowns

    • Perform rescue experiments with one protein in the absence of the other

    • Compare phenotypic impacts of individual versus combined targeting

  • Interaction studies:

    • Investigate direct protein-protein interactions

    • Map shared versus unique interactomes

    • Determine if they form heterodimeric complexes

Limited evidence suggests co-expression of CMTM6 and CMTM4 on tumor epithelium may have clinical significance, but further research is needed to fully elucidate their cooperative or compensatory roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.