Recombinant Human Clarin-2 (CLRN2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CLRN2; Clarin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CLRN2
Target Protein Sequence
MPGWFKKAWYGLASLLSFSSFILIIVALVVPHWLSGKILCQTGVDLVNATDRELVKFIGD IYYGLFRGCKVRQCGLGGRQSQFTIFPHLVKELNAGLHVMILLLLFLALALALVSMGFAI LNMIQVPYRAVSGPGGICLWNVLAGGVVALAIASFVAAVKFHDLTERIANFQEKLFQFVV VEEQYEESFWICVASASAHAANLVVVAISQIPLPEIKTKIEEATVTAEDILY
Uniprot No.

Target Background

Database Links

HGNC: 33939

KEGG: hsa:645104

STRING: 9606.ENSP00000424711

UniGene: Hs.631526

Protein Families
Clarin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of human CLRN2?

CLRN2 belongs to the Clarin family of proteins, which are small integral membrane glycoproteins characterized by four transmembrane alpha-helical domains. Human CLRN2 contains no known functional domains apart from these transmembrane regions and a C-terminal class-II PDZ-binding motif (PBM type II) . The protein is encoded by the CLRN2 gene (HGNC: 33939, NCBI Gene: 645104) located on chromosome 4p15.32p15.1 . CLRN2 is part of a larger superfamily that includes Tetraspanins, Connexins, Claudins, Occludins, and calcium channel gamma subunit-like proteins . This structural organization suggests potential roles in membrane organization and protein scaffolding within sensory cells.

How is CLRN2 expression regulated in the inner ear?

While the exact transcriptional regulation of CLRN2 has not been fully characterized, expression studies show that CLRN2 is enriched in cochlear hair cells, particularly in stereocilia . Unlike some hearing-related proteins that are transiently expressed during development, CLRN2 appears to maintain expression in mature hair cells, consistent with its role in stereocilia maintenance rather than initial formation . Research indicates that CLRN2 localization is particularly important in the mechanosensory hair bundle, suggesting tissue-specific regulatory mechanisms that ensure proper protein targeting to these specialized structures .

What methodologies are most effective for detecting CLRN2 expression in tissue samples?

For detection of CLRN2 in tissue samples, researchers have successfully employed:

  • RT-PCR for mRNA expression analysis using sequence-specific primers that can distinguish between splice variants

  • Immunohistochemistry with antibodies targeting specific epitopes within the CLRN2 protein

  • In situ hybridization for spatial localization of mRNA expression

  • Expression of tagged CLRN2 proteins (e.g., GFP-tagged) in cochlear culture systems

When examining CLRN2 within stereocilia, high-resolution confocal or super-resolution microscopy is recommended due to the small size and complex architecture of these structures. For analyzing the effects of mutations, mini-gene assays and in vitro splicing analysis have proven valuable, particularly for identifying aberrant splicing events caused by variants like c.494C>A .

What animal models are available for studying CLRN2 function?

Two primary mouse models have been developed for studying CLRN2 function:

  • Clarinet mouse (Clrn2clarinet): Contains an ENU-induced p.Trp4* nonsense mutation leading to early protein truncation and likely complete loss of function

  • CRISPR/Cas9-induced mutant (Clrn2del629): A second engineered mutant that has been used to confirm phenotypes observed in the clarinet model

Additionally, zebrafish models have been developed using CRISPR/Cas9 genome editing targeting multiple sites in the clrn2 gene . These zebrafish "crispants" were generated using five independent sgRNAs and Cas9 protein to create indels in the gene. This approach allows for rapid assessment of phenotypes without establishing stable genetic lines .

How does CLRN2 differ functionally from other clarin family members?

The clarin family in humans comprises three proteins: CLRN1, CLRN2, and CLRN3. While structurally similar, they exhibit important functional differences:

PropertyCLRN1CLRN2CLRN3
Associated DiseaseUsher syndrome type 3A (USH3A)Non-syndromic hearing lossNone reported
PhenotypeProgressive hearing loss, vestibular dysfunction, retinitis pigmentosaProgressive hearing loss without overt retinal deficitsUnknown
Expression PatternCochlea, retina, vestibular systemPrimarily cochleaNot well characterized
Effect on StereociliaRequired for initial formation and maintenanceRequired for maintenance but not initial formationUnknown

These differences highlight CLRN2's more specialized role in auditory function compared to CLRN1's broader involvement in multiple sensory systems . Understanding these distinctions provides important insights into the tissue-specific functions of tetraspan proteins in sensory epithelia.

What molecular mechanisms underlie CLRN2-mediated maintenance of stereocilia integrity?

CLRN2 is critical for maintaining stereocilia integrity through several proposed mechanisms:

  • Structural stability: CLRN2 likely contributes to the structural integrity of the actin-rich stereocilia, potentially through interactions with the cytoskeleton or other structural proteins .

  • Mechano-electrical transduction (MET) support: Studies in CLRN2-deficient mice demonstrate decreased MET function, suggesting CLRN2 either directly interacts with MET channel components or maintains the structural environment necessary for proper mechanotransduction .

  • Prevention of stereocilia resorption: In CLRN2-deficient mice, selective resorption of transducing stereocilia is observed, indicating CLRN2 may protect against stereocilia degradation, possibly by regulating actin dynamics or membrane composition .

Loss of CLRN2 leads to a progressive deterioration sequence: first, reduction in mechano-electrical transduction, followed by selective loss of transducing stereocilia, and ultimately hearing impairment . This suggests CLRN2 functions within a molecular network that links mechanical forces to cellular maintenance pathways in sensory hair cells.

What are the effects of different CLRN2 mutations on protein function and disease progression?

Different CLRN2 mutations can affect protein function through distinct mechanisms:

  • Nonsense mutations: The p.Trp4* mutation in the clarinet mouse results in early truncation, likely causing complete loss of functional protein .

  • Missense mutations: The c.494C>A (p.Thr165Lys) variant identified in a consanguineous Iranian family substitutes a highly conserved uncharged threonine with a charged lysine, potentially disrupting protein folding or interaction surfaces .

  • Splicing mutations: The same c.494C>A variant also causes aberrant splicing with retention of intron 2, resulting in a frameshift and premature stop codon (p.Gly146Lysfs*26) .

Analysis using I-TASSER for protein structure prediction has been employed to assess the potential impact of amino acid substitutions on CLRN2 structure . In vitro splicing assays (mini-genes) have proven valuable for experimentally verifying the effects of variants on mRNA processing. These approaches reveal that CLRN2 mutations can disrupt both protein structure and expression levels, contributing to phenotypic variability in hearing loss progression .

How can mechano-electrical transduction defects be quantitatively assessed in CLRN2 mutant models?

Mechano-electrical transduction (MET) defects in CLRN2 mutant models can be assessed through several complementary approaches:

  • Electrophysiological recordings: Whole-cell patch-clamp recordings of hair cells can measure MET currents in response to stereocilia deflection. In CLRN2-deficient models, these measurements show decreased amplitude of mechanically evoked currents .

  • FM1-43 dye uptake assays: This technique relies on the rapid entry of the styryl dye FM1-43 through functional MET channels. Reduced dye uptake in hair cells indicates compromised MET function .

  • High-resolution imaging of stereocilia bundle morphology: Using scanning electron microscopy (SEM) or super-resolution light microscopy to visualize stereocilia bundle integrity and correlate structural changes with functional deficits .

  • Calcium imaging: Using calcium indicators to visualize calcium influx through MET channels during bundle deflection provides spatial information about channel function across the stereocilia bundle.

Combined assessment of structure and function is essential, as CLRN2 deficiency leads to both functional MET defects and subsequent stereocilia structural deterioration, with a characteristic pattern of selective loss of the transducing stereocilia .

What are the emerging genetic approaches for investigating CLRN2 function in hearing?

Several cutting-edge genetic approaches are being utilized to investigate CLRN2 function:

  • CRISPR/Cas9 genome editing: Used to generate precise mutations in mouse and zebrafish models. For zebrafish crispants, multiple sgRNAs targeting different regions of clrn2 have been employed simultaneously to ensure efficient gene disruption .

  • Mini-gene splice assays: Essential for characterizing splicing effects of variants, these involve cloning genomic fragments containing exons and introns into expression vectors (like pET01 Exontrap or pSPL3b) .

  • Site-directed mutagenesis: Used to introduce specific mutations into wild-type sequences for functional testing, as demonstrated with the QuikChange Lightning system .

  • Inference of CRISPR Edits (ICE) analysis: Applied to characterize indel patterns in CRISPR-edited models, allowing quantitative assessment of editing efficiency and mutation profiles .

  • UK Biobank association studies: Large population studies that have successfully linked CLRN2 genetic variation to adult hearing difficulty, providing human relevance to laboratory findings .

These complementary approaches allow for multifaceted investigation of CLRN2 function from molecular mechanisms to population-level phenotypic associations.

What is known about the temporal dynamics of CLRN2-associated hearing loss progression?

CLRN2-associated hearing loss exhibits distinct temporal dynamics characterized by:

  • Normal initial development: In both mouse models and human cases, initial hearing development appears normal, with functional stereocilia bundles forming properly during embryonic and early postnatal development .

  • Early-onset deterioration: Hearing loss begins at an early age in Clrn2clarinet mice, with significant threshold elevations detectable by ABR testing at 3 months of age .

  • Progressive nature: The hearing loss is progressive rather than stable, with increasing severity over time in both mouse models and human patients .

  • Selective vulnerability: The deterioration follows a specific sequence: first reduced MET function, followed by selective loss of transducing stereocilia, ultimately resulting in complete hearing impairment .

These temporal characteristics suggest CLRN2 is particularly important during a critical maintenance phase after initial development, and its absence leads to failure of long-term stereocilia homeostasis. This pattern distinguishes CLRN2-related hearing loss from forms caused by developmental defects and suggests potential therapeutic windows for intervention before irreversible structural damage occurs .

How do comparative studies between CLRN1 and CLRN2 inform our understanding of sensory maintenance mechanisms?

Comparative studies between CLRN1 and CLRN2 reveal important insights about sensory maintenance mechanisms:

FeatureCLRN1CLRN2Implications
Tissue specificityCochlea, retina, vestibular systemPrimarily cochleaCLRN2 has more specialized function
Timing of actionRequired for both formation and maintenanceRequired for maintenance onlyDifferent roles in developmental vs. homeostatic processes
Associated diseaseUsher syndrome (hearing + vision loss)Non-syndromic hearing lossTissue-specific vulnerabilities to tetraspan protein deficiency
Stereocilia effectsDisrupted stereocilia bundles in early postnatal periodNormal initial bundle formation with subsequent deteriorationDistinct molecular pathways for formation vs. maintenance

These differences suggest that while both proteins share structural similarities as tetraspan proteins, they operate in distinct molecular pathways and temporal windows . CLRN1 appears to have evolved broader functions across multiple sensory systems, while CLRN2 specialization suggests potential redundancy in some tissues but critical non-redundant functions in cochlear hair cells.

The comparative analysis highlights how structurally related proteins can develop specialized roles in sensory maintenance, with loss of either protein leading to sensory deficits through distinct pathophysiological mechanisms .

What expression systems are optimal for producing recombinant human CLRN2 protein?

For recombinant human CLRN2 production, several expression systems have been utilized with varying advantages:

  • Mammalian cell systems (e.g., HEK293T cells): Provide proper post-translational modifications and membrane insertion for this tetraspan membrane protein. These systems have been successfully used for mini-gene splice assays and protein localization studies .

  • Cochlear explant cultures: Valuable for studying CLRN2 localization in its native cellular environment, allowing visualization of tagged CLRN2 within stereocilia bundles .

  • In vitro transcription/translation systems: Useful for producing smaller amounts of protein for biochemical characterization.

When expressing CLRN2, consideration must be given to:

  • Inclusion of appropriate epitope tags that don't interfere with protein folding or localization

  • Preservation of the C-terminal PDZ-binding motif, which may be critical for protein interactions

  • Selection of promoters appropriate for the expression level desired

  • Inclusion of proper signal sequences for membrane targeting

For functional studies, expression in cochlear or vestibular hair cells provides the most physiologically relevant context, though technical challenges with these primary cultures must be considered.

What methodologies are most effective for studying CLRN2 protein-protein interactions in stereocilia?

Several complementary approaches are valuable for investigating CLRN2 protein-protein interactions in stereocilia:

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify proteins in close proximity to CLRN2 within the stereocilia, overcoming challenges of traditional pull-downs with membrane proteins.

  • Co-immunoprecipitation from cochlear extracts: While challenging due to low abundance, this approach can verify direct interactions with candidate proteins.

  • Yeast two-hybrid screening: Useful for identifying potential binding partners, particularly for cytoplasmic domains of CLRN2.

  • PDZ-domain protein arrays: Since CLRN2 contains a C-terminal PDZ-binding motif, screening against arrays of PDZ-domain containing proteins can identify specific interactions .

  • FRET or BRET assays: For analyzing protein interactions in living cells, these approaches can detect proximity between CLRN2 and candidate partners.

  • Co-localization studies: High-resolution imaging techniques like STORM or STED microscopy can determine whether CLRN2 co-localizes with known stereocilia proteins.

The choice of method depends on the specific aspect of CLRN2 interaction being investigated, with consideration of the challenges presented by studying proteins within the small, densely packed stereocilia structure.

How can CLRN2 function be assessed in in vitro models of cochlear hair cells?

Assessment of CLRN2 function in in vitro models requires specialized approaches tailored to cochlear hair cell biology:

  • Organotypic cochlear cultures: Maintaining the 3D architecture of the organ of Corti allows for functional assessment of native hair cells with genetic or pharmacological manipulation of CLRN2 .

  • Hair cell-like cells derived from stem cells: These models allow for genetic manipulation and longitudinal studies of CLRN2 function during differentiation and maturation.

  • Functional assays in cultured systems:

    • FM1-43 dye uptake to assess MET channel activity

    • Calcium imaging to visualize mechanically-evoked responses

    • Time-lapse imaging to monitor stereocilia bundle morphology and integrity over time

    • Electrophysiological recordings to directly measure mechanotransduction currents

  • Molecular replacement studies: Expressing wild-type or mutant CLRN2 in CLRN2-deficient cells to assess rescue of phenotypes, allowing structure-function analysis of specific protein domains.

  • Pharmacological manipulation: Using cytoskeletal drugs to probe relationships between CLRN2, actin dynamics, and stereocilia stability.

These approaches enable detailed analysis of CLRN2's role in maintaining stereocilia structure and function, though they require specialized expertise in inner ear cell biology and physiology.

What genomic analysis approaches can identify novel CLRN2 variants in hearing loss patients?

The identification of novel CLRN2 variants in hearing loss patients can be achieved through several genomic approaches:

  • Whole exome sequencing (WES): Effectively used to identify the c.494C>A variant in a consanguineous Iranian family with non-syndromic hearing loss. Technical specifications include:

    • Capture kit: SureSelect Target Enrichment v6 (Agilent)

    • Sequencing platform: HiSeq4000 (Illumina)

    • Analysis pipeline: BWA for read mapping, Picard for duplicate removal, GATK for variant calling

  • Filtering strategies for variant prioritization:

    • Coverage > 10X

    • Phred quality score ≥ 30

    • Minor allele frequency (MAF) ≤ 0.005 in population databases

    • Segregation analysis in families

  • Homozygosity mapping: Particularly valuable in consanguineous families to identify regions of homozygosity that may contain recessive disease-causing variants. This approach helped identify a 14.96 Mb locus on chromosome 4p15.32p15.1 containing CLRN2 .

  • Population-based association studies: Large cohorts like the UK Biobank (n=250,389) have been used to associate CLRN2 variants with age-related hearing loss in the general population .

  • Validation methods for variant significance:

    • In vitro splicing assays for variants potentially affecting splicing

    • Protein structure modeling using I-TASSER

    • Functional studies in cell culture systems

These approaches have successfully identified CLRN2 as a deafness gene and will likely uncover additional variants associated with hearing loss phenotypes.

What therapeutic strategies might address CLRN2-associated hearing loss?

Several therapeutic strategies show potential for addressing CLRN2-associated hearing loss:

  • Gene replacement therapy: Delivering functional CLRN2 using viral vectors (such as AAV) to cochlear hair cells before irreversible stereocilia degeneration occurs. The progressive nature of the hearing loss provides a potential therapeutic window after diagnosis but before complete sensory cell loss .

  • Antisense oligonucleotides (ASOs): For splice-affecting mutations like c.494C>A, ASOs could potentially correct aberrant splicing and restore normal protein expression .

  • Small molecule stabilizers: Compounds that could stabilize stereocilia structure in the absence of functional CLRN2, potentially by targeting downstream pathways involved in stereocilia maintenance.

  • Cytoskeletal modulators: Since CLRN2 deficiency affects the actin-rich stereocilia, compounds that modulate actin dynamics might help preserve stereocilia integrity.

  • Protein replacement strategies: Development of recombinant CLRN2 protein with cell-penetrating peptides or other delivery mechanisms to target hair cells.

The temporal progression of CLRN2-associated hearing loss, with normal initial development followed by maintenance failure, suggests early intervention might prevent irreversible stereocilia loss . The confined nature of the inner ear makes local delivery approaches particularly promising for these therapeutic strategies.

How can high-throughput screening approaches identify compounds that preserve stereocilia in CLRN2 deficiency?

High-throughput screening (HTS) for compounds that preserve stereocilia in CLRN2 deficiency requires specialized approaches:

  • Cellular models for screening:

    • Immortalized cell lines expressing CLRN2 and stereocilia-like protrusions

    • Organotypic cochlear cultures from CLRN2-deficient mice

    • Differentiated inner ear organoids from stem cells

  • Readout parameters for screening assays:

    • Stereocilia bundle morphology using automated imaging

    • FM1-43 uptake as a proxy for MET function

    • Expression of stereocilia markers

    • Actin dynamics and stability measurements

  • Compound libraries to consider:

    • FDA-approved drug libraries for repurposing potential

    • Natural product collections

    • Focused libraries targeting cytoskeletal dynamics

    • Compounds known to affect PDZ-domain interactions

  • Validation approaches:

    • Dose-response testing in multiple model systems

    • Electrophysiological assessment of MET function

    • Long-term studies of stereocilia maintenance

    • In vivo testing in CLRN2-deficient mouse models

The ideal compounds would prevent stereocilia deterioration without toxic effects on hair cells and would be amenable to local delivery to the inner ear. Secondary screens would need to assess compound effects on auditory function and long-term stereocilia integrity.

What are the critical knowledge gaps in understanding CLRN2 biology?

Several critical knowledge gaps exist in our understanding of CLRN2 biology:

  • Molecular interactions: The specific protein binding partners of CLRN2 in stereocilia remain largely unknown. Identifying these interactors would clarify how CLRN2 contributes to stereocilia maintenance .

  • Precise subcellular localization: While CLRN2 is enriched in stereocilia, its exact localization pattern within the complex 3D architecture of the stereocilia bundle requires further characterization using super-resolution microscopy .

  • Functional domains: The specific roles of CLRN2's transmembrane domains and PDZ-binding motif in protein function have not been fully elucidated .

  • Developmental regulation: The temporal and spatial regulation of CLRN2 expression during inner ear development and maturation requires further investigation.

  • Relationship to MET machinery: How CLRN2 functionally interacts with or supports the mechano-electrical transduction apparatus remains unclear .

  • Species-specific differences: Potential differences in CLRN2 function between model organisms and humans need further exploration to ensure translational relevance.

  • Redundancy mechanisms: Why CLRN2 deficiency affects hearing but not vision (unlike CLRN1) requires investigation into potential redundancy mechanisms in different sensory systems .

Addressing these knowledge gaps would significantly advance our understanding of CLRN2 function and potentially reveal new therapeutic targets for hearing loss.

How might technological advances in inner ear research accelerate CLRN2 studies?

Emerging technologies are poised to accelerate CLRN2 research in several ways:

  • Single-cell transcriptomics: Enabling precise characterization of CLRN2 expression across different cell types in the inner ear and how expression changes in response to genetic or environmental perturbations.

  • CRISPR-based screening: Facilitating identification of genetic modifiers that influence CLRN2-associated phenotypes through genome-wide or targeted screens.

  • Inner ear organoids: Derived from human stem cells, these 3D culture systems can recapitulate aspects of inner ear development and function, allowing studies of human CLRN2 in a more physiologically relevant context .

  • Super-resolution microscopy: Techniques like STORM, STED, and expansion microscopy enable visualization of protein localization within the nanoscale architecture of stereocilia, crucial for understanding CLRN2's precise localization and interactions .

  • Local gene editing approaches: Methods for precise in vivo editing of CLRN2 in specific cell types at defined developmental stages.

  • Improved inner ear drug delivery: Novel approaches for targeted delivery of compounds to cochlear hair cells with improved specificity and duration.

  • Proteomics advances: Techniques for analyzing the proteome of small numbers of cells or even subcellular structures like stereocilia bundles, facilitating identification of CLRN2-associated protein complexes.

These technological advances will enable more precise characterization of CLRN2 function and potentially accelerate the development of therapeutic interventions for CLRN2-associated hearing loss.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.