Recombinant Human Clarin-3 (CLRN3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
CLRN3; TMEM12; USH3AL1; Clarin-3; Transmembrane protein 12; Usher syndrome type-3A-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CLRN3
Target Protein Sequence
MPTTKKTLMFLSSFFTSLGSFIVICSILGTQAWITSTIAVRDSASNGSIFITYGLFRGES SEELSHGLAEPKKKFAVLEILNNSSQKTLHSVTILFLVLSLITSLLSSGFTFYNSISNPY QTFLGPTGVYTWNGLGASFVFVTMILFVANTQSNQLSEELFQMLYPATTSKGTTHSYGYS FWLILLVILLNIVTVTIIIFYQKARYQRKQEQRKPMEYAPRDGILF
Uniprot No.

Target Background

Gene References Into Functions
  1. The SNP rs6482992 in the CLRN3 gene had the smallest p value in analyses of the cognitive outcome. PMID: 22658654
Database Links

HGNC: 20795

KEGG: hsa:119467

STRING: 9606.ENSP00000357660

UniGene: Hs.242014

Protein Families
Clarin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Clarin-3 (CLRN3) and how does it relate to other clarin family members?

Clarin-3 (CLRN3) belongs to the clarin family of proteins, which includes Clarin-1 (associated with Usher syndrome type 3) and Clarin-2. All clarins are members of the larger tetraspanin hyperfamily of small integral proteins with transmembrane domains. Like CLRN1, CLRN3 is predicted to contain four transmembrane domains, similar to other tetraspanins, connexins, and calcium channel gamma subunit-like proteins .

The clarin family shares structural features with stargazin (CACNG2), a tetraspanin involved in regulation of AMPA receptors targeting and clustering at cerebellar synapses . While CLRN1 has been studied extensively in the context of sensory systems, the specific functions of CLRN3 remain less characterized, though its structural similarity suggests it may play roles in membrane organization, protein trafficking, or cell signaling.

What alternative nomenclature exists for CLRN3 in scientific literature?

Researchers should be aware of multiple designations for CLRN3 when conducting literature searches:

  • TMEM12 (transmembrane protein 12)

  • USH3AL1 (usher syndrome type-3A-like protein 1)

  • Clarin-3

  • MGC32871

  • DKFZp686F11218

This diverse nomenclature reflects the evolving understanding of this protein. When designing experiments or searching databases, all these terms should be included to ensure comprehensive results.

What is currently known about CLRN3 expression patterns in human tissues?

While the search results don't provide specific information about CLRN3 expression patterns, we can draw parallels from the related CLRN1. CLRN1 shows tissue-specific expression with alternative splicing producing distinct isoforms. Research methodologies to determine CLRN3 expression should include:

  • RNAscope in situ hybridization assays, which have successfully detected low-abundance transcripts of CLRN1 in retinal tissues

  • Single-cell RNA-sequencing to identify cell-specific expression patterns

  • RT-PCR using primers designed to comprise the entire coding sequence

  • Western blot analysis following appropriate protein extraction protocols

For comprehensive tissue expression profiling, researchers should employ both transcript-level (RT-PCR, RNA-seq) and protein-level (immunoblotting, immunohistochemistry) detection methods.

How does the structure of CLRN3 compare to CLRN1, and what implications might this have for function?

Based on sequence homology analysis, CLRN3 and CLRN1 share structural features as members of the tetraspanin hyperfamily. CLRN1 contains four transmembrane domains in its primary isoforms, with alternative splicing producing at least three distinct protein isoforms :

IsoformMolecular WeightTransmembrane DomainsKnown Features
CLRN1 Isoform 127.9 kDaFourFull-length protein
CLRN1 Isoform 225.8 kDaFourMain isoform detected in cochlea and retina
CLRN1 Isoform 319.2 kDaTwoTruncated form

By inference, CLRN3 likely has a similar domain organization with four transmembrane segments, though specific isoforms may differ. The structural similarity to CLRN1 suggests CLRN3 may have roles in:

  • Cell-cell interactions

  • Membrane organization

  • Protein scaffolding

  • Signaling complex formation

The tetramembrane structure places CLRN3 in a protein family involved in organizing membrane microdomains, potentially critical for sensory cell function.

What are recommended approaches for detecting recombinant CLRN3 in experimental systems?

Based on successful methods used for CLRN1, the following approaches are recommended for CLRN3 detection:

Western Blot Protocol:

  • Resolve 20-40 μg of protein extract on 10% SDS-PAGE under reducing conditions

  • Transfer to PVDF membranes for 1 hour using 100 V at 4°C

  • Block overnight at 4°C with 10% non-fat dry milk containing 0.1% Tween 20

  • Incubate with primary antibody diluted in blocking solution overnight at 4°C

  • Wash thoroughly and incubate with HRP-conjugated secondary antibody

  • Develop using ECL system

Qualification Controls:

  • Include appropriate positive controls (transfected cells overexpressing CLRN3)

  • Use competitive inhibition with fusion protein antigen to validate antibody specificity

  • Implement siRNA knockdown to confirm band specificity

  • Include β-actin as loading control

For challenging detection scenarios, epitope tagging (e.g., HA, FLAG) of recombinant CLRN3 can significantly improve detection sensitivity, as demonstrated with CLRN1 in knock-in mouse models .

What expression systems are optimal for producing functional recombinant human CLRN3?

Several expression systems have been successfully used for recombinant clarin proteins:

Expression SystemAdvantagesConsiderations
Mammalian Cells (HEK293)Native-like post-translational modifications; correct membrane targetingHigher cost; lower yield
E. coliHigh yield; cost-effectiveLack of glycosylation; potential folding issues
Stable Cell LinesConsistent expression; good for functional studiesTime-consuming to generate

For functional studies, mammalian expression systems are strongly recommended as they:

  • Provide appropriate glycosylation, which may be critical as seen with CLRN1 N48K mutation affecting N-glycosylation

  • Enable proper membrane trafficking and localization

  • Support interaction studies with potential binding partners

For structural studies requiring high protein yields, bacterial systems may be used but require optimization of solubilization and refolding protocols.

What experimental approaches are recommended to investigate CLRN3 function in sensory systems?

Based on research strategies with CLRN1, the following approaches would be valuable for investigating CLRN3:

Genetic Models:

  • Generate knockout/knockin models using CRISPR-Cas9 or zinc finger nucleases as successfully employed for CLRN1

  • Develop transgenic models expressing wild-type or mutated CLRN3 to assess protein localization and function

Cellular Localization Studies:

  • Use immunofluorescence with validated antibodies or epitope-tagged constructs

  • Employ super-resolution microscopy to determine precise subcellular localization

  • Combine with markers for cellular compartments to determine trafficking patterns

Functional Assays:

  • Examine potential roles in mechanosensory function through electrophysiological recordings

  • Investigate membrane dynamics using FRAP (Fluorescence Recovery After Photobleaching)

  • Assess protein-protein interactions through co-immunoprecipitation, proximity ligation assays, or FRET

These approaches should be implemented in relevant model systems, including sensory cell types if CLRN3 exhibits expression patterns similar to CLRN1.

How can researchers identify and characterize potential CLRN3 interaction partners?

To identify CLRN3 interaction partners, researchers should employ multiple complementary approaches:

Biochemical Approaches:

  • Co-immunoprecipitation using epitope-tagged CLRN3 or specific antibodies

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • Cross-linking mass spectrometry to identify direct binding partners

Genetic Approaches:

  • Yeast two-hybrid screening using CLRN3 domains as bait

  • Genetic interaction screens in model systems

  • Comparative analysis with known CLRN1 interactors

Current evidence indicates ZDHHC17 as a potential interaction partner for CLRN3 . This protein is a palmitoyl acyltransferase, suggesting CLRN3 may undergo palmitoylation, a post-translational modification that affects protein localization and function. Verification of this interaction through multiple methods would provide insight into CLRN3 regulation.

What are common challenges in working with recombinant CLRN3 and how can they be addressed?

Based on experience with related membrane proteins like CLRN1, several challenges may arise when working with CLRN3:

Low Expression Levels:

  • Challenge: Membrane proteins often express poorly in heterologous systems

  • Solution: Optimize codon usage for expression system; use inducible promoters; consider fusion tags that enhance expression (e.g., SUMO)

Protein Degradation:

  • Challenge: Misfolded membrane proteins trigger degradation pathways

  • Solution: Lower expression temperature; include proteasome inhibitors during extraction; use glycosylation site mutants to assess stability

Antibody Specificity:

  • Challenge: Cross-reactivity with other clarin family members

  • Solution: Validate antibodies using knockout controls; employ competitive inhibition with immunizing peptide; use epitope-tagged constructs as positive controls

Membrane Protein Solubilization:

  • Challenge: Maintaining native conformation during extraction

  • Solution: Screen multiple detergents (mild non-ionic like DDM or digitonin); use native membrane preparations for functional studies; consider nanodiscs for maintaining native environment

What methodological considerations are crucial when studying post-translational modifications of CLRN3?

Post-translational modifications likely play critical roles in CLRN3 function, as demonstrated by the importance of N-glycosylation for CLRN1 . Researchers should consider:

Glycosylation Analysis:

  • Use enzymatic deglycosylation (PNGase F for N-linked glycans) followed by immunoblotting to detect mobility shifts

  • Generate glycosylation site mutants to assess functional importance

  • Apply lectin-based detection methods to characterize glycan structures

Palmitoylation Assessment:

  • Given the interaction with ZDHHC17, analyze palmitoylation status using click chemistry with alkyne-palmitate

  • Employ hydroxylamine sensitivity assays to confirm thioester linkages

  • Generate cysteine mutants to identify palmitoylation sites

Phosphorylation Studies:

  • Use phospho-specific antibodies or phospho-enrichment followed by mass spectrometry

  • Apply kinase inhibitors to identify relevant signaling pathways

  • Generate phosphomimetic and phospho-null mutants to assess functional consequences

These approaches will provide mechanistic insights into how post-translational modifications regulate CLRN3 localization, stability, and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.