Recombinant Human Claudin-10 (CLDN10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Claudin-10 (CLDN10)

Recombinant Human Claudin-10 (CLDN10) is a membrane integral protein that belongs to the claudin family, which plays a crucial role in forming tight junctions in various tissues. Tight junctions are essential for maintaining cellular integrity and controlling paracellular transport, which involves the movement of ions and molecules through the space between cells. CLDN10 is particularly noted for its expression in brain endothelial cells and its involvement in kidney function, where it influences ion transport and permeability .

Structure and Expression of CLDN10

CLDN10 is a full-length protein consisting of 228 amino acids, expressed in wheat germ for research purposes . It is primarily found in two isoforms: claudin-10a and claudin-10b, which function as paracellular anion and cation channels, respectively . The expression of CLDN10 is significant in brain endothelial cells, where it contributes to the blood-brain barrier's integrity, and in the kidneys, particularly in the proximal tubules and thick ascending limbs .

Role in the Blood-Brain Barrier

In brain endothelial cells, CLDN10 is crucial for maintaining tight junctions, which are essential for the blood-brain barrier's function. This barrier controls the passage of substances between the bloodstream and the brain, protecting the brain from harmful substances. Studies have shown that knockdown of CLDN10 in brain endothelial cells leads to impaired tight junctions, increased paracellular permeability, and enhanced invasion of cancer cells through the endothelial layer .

Ion Transport in the Kidneys

In the kidneys, CLDN10a is vital for paracellular chloride transport in the proximal tubules, while CLDN10b facilitates sodium transport in the thick ascending limb. Deficiency in CLDN10a can lead to altered ion transport properties, resulting in electrolyte imbalances such as hypermagnesemia . Mutations affecting both isoforms can cause severe kidney dysfunction, as seen in HELIX syndrome, characterized by hypokalemia, hypermagnesemia, and other electrolyte disturbances .

Prognostic Marker for Ovarian Cancer

Recent studies have identified CLDN10 as a potential prognostic marker for ovarian cancer. Low expression levels of CLDN10 are associated with a poorer prognosis, suggesting its role in cancer progression, possibly through pathways like epithelial-to-mesenchymal transition (EMT) .

Use in Drug Delivery

The role of CLDN10 in controlling paracellular permeability makes it a target for enhancing drug delivery across the blood-brain barrier. Knockdown of CLDN10 can increase the transendothelial delivery of chemotherapeutic drugs, offering potential strategies for improving brain cancer treatment .

Expression and Function of CLDN10 Isoforms

IsoformFunctionLocation
Claudin-10aParacellular anion channelProximal tubules
Claudin-10bParacellular cation channelThick ascending limb

Clinical Relevance of CLDN10 Expression

ConditionEffect of Low CLDN10 Expression
Ovarian CancerPoorer prognosis, increased risk of recurrence
Kidney FunctionElectrolyte imbalance, hypermagnesemia

Research Tools for CLDN10

ToolDescription
Recombinant Human CLDN10 ProteinExpressed in wheat germ, suitable for ELISA and Western blotting
Cell ModelsBrain endothelial cells with altered CLDN10 expression for studying tight junction function

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CLDN10; Claudin-10; Oligodendrocyte-specific protein-like; OSP-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CLDN10
Target Protein Sequence
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLA GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC FSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
Uniprot No.

Target Background

Function
Claudin-10 plays a crucial role in tight junction-mediated obliteration of intercellular space via calcium-independent cell adhesion. It regulates paracellular epithelial permeability to ions in various organs, functioning as a paracellular ion channel forming permselective pores. Isoform 1 exhibits preferential permeability to cations, while isoform 2 shows preference for anions. In sweat glands and the thick ascending limb (TAL) of Henle's loop in the kidney, Claudin-10 controls paracellular sodium permeability, essential for sweat production and renal function.
Gene References Into Functions
  1. A study found a significant association between the CLDN10 polymorphism rs1325774 and increased breast cancer risk, particularly with the G allele. However, no significant association was observed for rs7333503 and rs3751334. PMID: 30544377
  2. Research indicates a pivotal role for claudin-10b in maintaining paracellular Na+ permeability for sweat production and kidney function, as demonstrated by phenotypes in mice with kidney-specific loss of both claudin-10 isoforms. PMID: 28686597
  3. Studies have localized Cldn3, Cldn7, and Cldn10 proteins in different compartments of murine endometrium up to day 8.5 of pregnancy (dpc), as well as in human endometrium and first-trimester decidua. PMID: 26340953
  4. Lower CLDN1 and CLDN10 expression was observed in invasive lepidic predominant adenocarcinoma compared to lung adenocarcinoma in situ. Overexpression indicated a favorable prognosis in some lung adenocarcinoma patients. PMID: 23591077
  5. Claudin-10 expression was down-regulated in gastric cancer. PMID: 24325792
  6. In claudin-10b, the F66L mutant reduced cation selectivity, and the F66A mutant lost pore conductance. PMID: 23760508
  7. Claudin-10/18 are frequently expressed in lung adenocarcinomas, particularly in female patients and non-smokers, suggesting a role in tobacco-unrelated carcinoma carcinogenesis. PMID: 22076167
  8. High Claudin-10 protein expression in hepatocellular carcinoma (HCC) tissue correlates with angiogenesis and predicts poor prognosis after hepatectomy. PMID: 21647678
  9. CLDN10 is a potential biomarker for detecting ovarian cancer in chickens, a suitable model for studying CLDN function in human ovarian cancer. PMID: 21370593
  10. High Claudin-10 expression is associated with primary hepatocellular carcinoma recurrence. PMID: 15701840
  11. CLDN-10 is functionally involved in hepatocellular carcinoma invasion and a potential therapeutic target. PMID: 18025272
  12. Claudin-10 has six alternatively spliced isoforms with distinct localization and function. PMID: 19383724
Database Links

HGNC: 2033

OMIM: 617579

KEGG: hsa:9071

STRING: 9606.ENSP00000299339

UniGene: Hs.534377

Involvement In Disease
HELIX syndrome (HELIX)
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the kidney, eccrine sweat glands and in all layers of the epidermis. In the kidney, it is detected in the thick ascending limb of Henle's loop (TAL). In the sweat glands, it is expressed in cells from secretory portions, corresponding to the

Q&A

What is Claudin-10 (CLDN10) and what are its primary functions?

CLDN10 is a member of the claudin family of tight junction proteins, with a full-length sequence of 228 amino acids in humans. It primarily functions by forming paracellular channels that polymerize in tight junction strands with both cation- and anion-selective properties. These channels convey epithelial permeability in a process known as paracellular tight junction permeability . The protein plays essential roles in controlling ion selectivity in epithelial barriers, particularly in renal tubules and sweat glands. CLDN10 is crucial for proper sweat production and renal function, contributing significantly to ion homeostasis across epithelial barriers .

What are the primary isoforms of CLDN10 and how do they differ functionally?

CLDN10 exists in two major isoforms with distinct functional properties:

IsoformAlternative NameSelectivityPrimary LocationFunction
Isoform 1 (CLDN10b)-Cation-selectiveTAL of Henle's loop, sweat glandsControls paracellular sodium permeability essential for proper sweat production and renal function
Isoform 2 (CLDN10a)-Anion-selectiveRenal proximal tubulesConveys selective chloride over hydrogencarbonate anion permeability required for renal chloride reabsorption and salt homeostasis

The differential expression of these isoforms creates segment-specific permeability properties throughout the nephron. Quantitative PCR analysis has confirmed that CLDN10a transcripts are abundant in the proximal convoluted tubule (PCT), whereas CLDN10b predominates in the thick ascending limb (TAL) .

What experimental techniques are most effective for studying Recombinant Human CLDN10?

Recombinant Human CLDN10 protein can be effectively studied using several methodological approaches:

  • Protein Expression and Purification: Recombinant Human CLDN10 can be expressed in Wheat germ expression systems, yielding the full-length protein (1-228 aa) .

  • Immunological Techniques: The protein is suitable for ELISA and Western Blot (WB) applications . When developing antibodies, monoclonal approaches may offer greater specificity, as demonstrated in recent studies .

  • Genetic Manipulation: Targeted deletion using homologous recombination and Cre-loxP systems allows for tissue-specific claudin-10 knockout models, such as the TAL-specific deletion model .

  • Electrophysiological Measurements: Isolated tubule preparations can be used for measuring transepithelial voltage (Vte), resistance (Rte), and paracellular ion permeability through dilution potential and bi-ionic diffusion potential measurements .

  • Immunolocalization: Immunofluorescence microscopy with co-staining for other tight junction proteins (e.g., ZO-1) or segment-specific markers (e.g., NKCC2 for TAL) helps determine the subcellular localization and tissue distribution of CLDN10 .

How does CLDN10 deletion affect paracellular ion selectivity in renal tubules?

Deletion of CLDN10 in the thick ascending limb (TAL) of Henle's loop dramatically alters paracellular permeability for monovalent and divalent cations. Experimental evidence from isolated tubule studies reveals several key findings:

  • Altered Transepithelial Properties: CLDN10 deletion results in a 1.6-fold increase in transepithelial voltage (Vte) and a 1.3-fold increase in transepithelial resistance (Rte), with no significant difference in short-circuit currents (I'sc) .

  • Changed Dilution Potentials: NaCl dilution potential is dramatically diminished in CLDN10-deficient mice (-4.2 ± 1.7 mV) compared to controls (-23.2 ± 1.3 mV) .

  • Reversed Bi-ionic Diffusion Potentials: The bi-ionic diffusion potentials (luminal Na+ against basolateral Mg2+ or Ca2+) change polarity in CLDN10-knockout tubules compared with controls:

    • For Mg2+: 4.9 ± 1.0 mV in knockout mice vs. -7.4 ± 1.1 mV in controls

    • For Ca2+: 11 ± 1.5 mV in knockout mice vs. -0.7 ± 1.2 mV in controls

  • Shifted Permeability Ratios: The calculated relative permeabilities show a decrease in PNa/PCl accompanied by strong increases in PMg/PNa and PCa/PNa, suggesting that the absence of CLDN10 alters the permeability sequence from favoring monovalent cations to favoring divalent cations .

These functional changes explain the phenotypic observations of hypermagnesemia and nephrocalcinosis in CLDN10-deficient mice.

What are the physiological consequences of CLDN10 deletion in the kidney?

The deletion of CLDN10 in the thick ascending limb leads to significant alterations in renal function and systemic ion homeostasis. The following table summarizes key physiological parameters altered in CLDN10-deficient mice compared to controls:

Parameter CategorySpecific ParameterControlsCLDN10 KnockoutSignificance
Serum ParametersMg2+ (mM/L)1.1 ± 0.02.0 ± 0.1***
Ca2+ (mM/L)2.3 ± 0.02.1 ± 0.0***
Phosphate (mM/L)2.8 ± 0.13.6 ± 0.2**
Urea (mM/L)22.7 ± 0.631.9 ± 1.0***
Urine ParametersFE Mg2+ (%)8.9 ± 0.94.5 ± 0.3***
FE Ca2+ (%)0.3 ± 0.00.2 ± 0.0*
pH6.3 ± 0.05.5 ± 0.0***
Osmolality (mOsm/kg)793 ± 44419 ± 21***
Urine volume (mL)2.6 ± 0.25.2 ± 0.2***
Drinking volume (mL)1.3 ± 0.23.2 ± 0.5**

*P < 0.05; **P < 0.01; ***P < 0.001

The most striking consequences include:

  • Hypermagnesemia: Almost twofold higher serum Mg2+ concentration with correspondingly reduced fractional excretion (FE) of Mg2+ (52% of control values) .

  • Nephrocalcinosis: Extensive medullary calcium deposits in the outer stripe of the outer medulla and at the transition to the inner medulla, as revealed by von Kossa and alizarin red S staining .

  • Polyuria and Polydipsia: Increased urine volume with decreased urine osmolality, accompanied by increased water intake .

  • Urinary Acidification: More acidic urine in knockout mice (pH 5.5 vs. 6.3 in controls) .

These findings demonstrate that CLDN10 is a key determinant of cation selectivity in the TAL, and its absence leads to a shift from paracellular sodium transport to hyperabsorption of calcium and magnesium.

What is the role of CLDN10 in cancer progression, particularly in renal cell carcinoma?

CLDN10 exhibits significant oncogenic potential in clear cell renal cell carcinoma (ccRCC), extending beyond its conventional tight junction functions. Research has demonstrated that:

  • Prognostic Value: High CLDN10 expression predicts poor outcome in ccRCC patients and represents an independent prognostic marker for cancer-specific survival .

  • Promotion of Malignant Phenotypes: Cell surface CLDN10 promotes multiple cancer hallmarks including:

    • Enhanced cell viability

    • Increased proliferation

    • Accelerated cell migration

    • Augmented tumor growth

  • Signaling Pathway Activation: CLDN10 activates the mTOR signaling pathway and the expression of downstream targets, including MYC target genes .

  • Protein-Protein Interactions: CLDN10 forms a complex with the amino acid transporter LAT1, and this CLDN10-LAT1 signaling axis facilitates malignant phenotypes in ccRCC cells .

  • Structural Interactions: Structural prediction and immunoprecipitation analyses strongly suggest an interaction between the first transmembrane domain of CLDN10 (CLDN10-TM1) and LAT1 .

These findings highlight CLDN10 as a potential therapeutic target in ccRCC and suggest that disrupting the CLDN10-LAT1 interaction might represent a novel approach for treating this aggressive cancer type.

How can researchers effectively investigate CLDN10 function using genetic knockout models?

Researchers can employ the following methodological approach to investigate CLDN10 function using genetic knockout models:

  • Conditional Knockout Strategy:

    • Generate mice with loxP sites flanking critical exons (e.g., exons 2 and 3) of the CLDN10 gene using homologous recombination in embryonic stem cells .

    • The targeted deletion should affect all splice variants (e.g., CLDN10a and CLDN10b) and result in a premature stop codon in all encoded isoforms .

  • Tissue-Specific Deletion:

    • Cross floxed CLDN10 mice with animals expressing Cre recombinase under a tissue-specific promoter (e.g., kidney-specific cadherin-16 promoter for TAL-specific deletion) .

    • This approach allows for studies of CLDN10 function in specific nephron segments while avoiding potential embryonic lethality of global knockouts.

  • Validation of Knockout Efficiency:

    • Confirm deletion at the protein level using Western blot analysis of tissue membrane extracts .

    • Verify segment-specific deletion using quantitative PCR (qPCR) with cDNA generated from isolated nephron segments .

    • Perform immunofluorescence microscopy with co-staining for segment-specific markers to visually confirm the absence of the protein in targeted segments .

  • Phenotypic Characterization:

    • Conduct histological examination using appropriate stains (e.g., von Kossa and alizarin red S for calcium deposits) .

    • Analyze serum and urine parameters, including electrolytes, acid-base status, and osmolality .

    • Calculate fractional excretion rates for various ions to assess specific tubular functions .

  • Functional Studies:

    • Perform ex vivo tubule perfusion studies to measure transepithelial voltage and resistance .

    • Conduct dilution potential and bi-ionic diffusion potential measurements to determine paracellular permeability properties .

    • Calculate relative ion permeabilities to assess changes in ion selectivity .

This comprehensive approach allows for detailed characterization of CLDN10's physiological roles and the consequences of its disruption in specific tissues or cell types.

What are the optimal expression systems for recombinant human CLDN10 production?

When producing recombinant human CLDN10 for research purposes, the choice of expression system is critical for obtaining functional protein. The available search results indicate that Wheat germ expression systems have been successfully used to produce full-length human CLDN10 protein (1-228 amino acids) . This system is particularly useful for producing membrane proteins like claudins, as it can facilitate proper folding and post-translational modifications.

For researchers designing CLDN10 expression experiments, several considerations are important:

  • Protein Sequence: Ensure that the complete amino acid sequence (1-228 aa) is included in the expression construct to maintain full functionality .

  • Fusion Tags: Consider the addition of purification tags that will facilitate downstream applications while minimally affecting protein function.

  • Membrane Integration: As CLDN10 is a transmembrane protein, expression systems must support proper membrane insertion and topology.

  • Isoform Selection: Choose the appropriate isoform (CLDN10a or CLDN10b) based on the specific research question, as they have distinct ion selectivity properties .

  • Functionality Testing: Verify the functionality of the recombinant protein using electrophysiological methods or permeability assays to ensure that it retains native channel-forming properties.

The recombinant protein produced should be suitable for various applications, including ELISA and Western blot analyses .

How can researchers effectively differentiate between CLDN10 isoforms in experimental settings?

Distinguishing between CLDN10 isoforms is critical for understanding their distinct functional roles. Researchers can employ the following methodological approaches:

  • Isoform-Specific PCR:

    • Design primers that target unique regions of CLDN10a and CLDN10b transcripts for quantitative PCR analysis.

    • This approach has successfully demonstrated that CLDN10a transcripts are abundant in the proximal convoluted tubule (PCT), whereas CLDN10b predominates in the thick ascending limb (TAL) .

  • Isoform-Specific Antibodies:

    • Develop antibodies that recognize unique epitopes in different CLDN10 isoforms.

    • The generation of monoclonal antibodies with high specificity can be achieved through careful epitope selection and comprehensive validation .

  • Functional Characterization:

    • Utilize the different ion selectivity properties of the isoforms for identification:

      • CLDN10a forms anion-selective paracellular channels

      • CLDN10b forms cation-selective paracellular channels

    • Perform permeability assays and electrophysiological measurements to differentiate between these functional properties.

  • Expression Pattern Analysis:

    • Map the tissue distribution of different isoforms using a combination of RT-PCR, Western blotting, and immunohistochemistry.

    • Correlate expression patterns with known functional properties of different nephron segments.

  • Isoform-Specific Knockdown/Knockout:

    • Design RNA interference or CRISPR-Cas9 targeting strategies specific to each isoform.

    • Validate the specificity of targeting by measuring remaining expression of each isoform.

These approaches, used in combination, provide robust methods for distinguishing between CLDN10 isoforms in experimental settings.

What are the implications of CLDN10 dysregulation in human diseases?

CLDN10 dysregulation has been implicated in several disease states, with significant clinical implications:

  • Renal Disorders:

    • Alterations in CLDN10 function may contribute to disorders of magnesium and calcium homeostasis.

    • The mouse knockout model demonstrates that CLDN10 deficiency leads to hypermagnesemia and nephrocalcinosis, suggesting that human CLDN10 mutations might underlie similar conditions .

    • The observed polyuria and altered urinary acidification in CLDN10-deficient models suggest potential roles in disorders of urinary concentration and acid-base balance .

  • Cancer Progression:

    • High CLDN10 expression represents an independent prognostic marker for poor cancer-specific survival in clear cell renal cell carcinoma (ccRCC) .

    • CLDN10 promotes multiple malignant phenotypes in ccRCC cells, including enhanced viability, proliferation, migration, and tumor growth .

    • The CLDN10-LAT1 interaction activates mTOR signaling and downstream targets, suggesting potential therapeutic targeting opportunities .

  • Epithelial Barrier Dysfunction:

    • Given CLDN10's role in paracellular ion transport, its dysregulation may contribute to disorders characterized by epithelial barrier dysfunction in various tissues.

    • Altered ion selectivity due to CLDN10 mutations or expression changes could disrupt tissue microenvironments and contribute to pathophysiology.

Understanding these disease associations provides researchers with potential translational directions for CLDN10-focused research.

How might the CLDN10-LAT1 interaction be targeted therapeutically in cancer?

The discovery that CLDN10 forms a complex with the amino acid transporter LAT1 to promote malignant phenotypes in clear cell renal cell carcinoma (ccRCC) suggests several therapeutic targeting strategies:

  • Disruption of Protein-Protein Interaction:

    • Structural prediction and immunoprecipitation analyses indicate an interaction between the first transmembrane domain of CLDN10 (CLDN10-TM1) and LAT1 .

    • Small molecule inhibitors or peptide mimetics could be designed to interfere with this specific interaction domain.

    • High-throughput screening approaches could identify compounds that selectively disrupt the CLDN10-LAT1 complex without affecting their individual functions in normal tissues.

  • Targeting Downstream Signaling Pathways:

    • CLDN10-LAT1 signaling activates the mTOR pathway and expression of downstream targets, including MYC target genes .

    • Combining CLDN10-LAT1 targeting with mTOR inhibitors might provide synergistic anti-cancer effects.

    • Pathway-specific inhibitors could selectively block the oncogenic signaling without disrupting essential cellular functions.

  • Antibody-Based Approaches:

    • Development of monoclonal antibodies that specifically recognize the extracellular domains of CLDN10 involved in LAT1 interaction.

    • These antibodies could potentially block the formation of the CLDN10-LAT1 complex or trigger internalization of CLDN10 from the cell surface.

  • Gene Therapy Approaches:

    • CRISPR-Cas9 or siRNA-based strategies could be developed to reduce CLDN10 expression specifically in tumor cells.

    • Viral vectors delivering such gene-modifying payloads could be targeted to ccRCC cells using tumor-specific markers.

These therapeutic strategies represent promising avenues for translating the fundamental understanding of CLDN10-LAT1 interaction into novel cancer treatments.

What are the most promising areas for future CLDN10 research?

Several promising research directions emerge from current understanding of CLDN10 biology:

  • Structural Biology:

    • Determining the three-dimensional structure of CLDN10 isoforms at atomic resolution would provide insights into its channel-forming properties.

    • Structural analysis of the CLDN10-LAT1 complex would facilitate rational drug design for cancer therapeutics.

    • Investigation of how CLDN10 interacts with other tight junction proteins to form functional barriers.

  • Functional Genomics:

    • Comprehensive analysis of CLDN10 genetic variants in human populations and their association with disease phenotypes.

    • Investigation of epigenetic regulation of CLDN10 expression in different tissues and disease states.

    • Single-cell transcriptomic profiling to understand cell-specific expression patterns of CLDN10 isoforms.

  • Systems Biology:

    • Integration of CLDN10 function into comprehensive models of epithelial transport.

    • Network analysis of CLDN10 interactors beyond LAT1 to identify additional signaling mechanisms.

    • Computational modeling of how CLDN10 expression changes affect ion homeostasis at tissue and organ levels.

  • Translational Research:

    • Development of selective CLDN10-LAT1 interaction inhibitors as potential cancer therapeutics.

    • Investigation of CLDN10 as a biomarker for renal diseases or cancer progression.

    • Exploration of CLDN10-targeting approaches for modulating epithelial permeability in drug delivery applications.

These research directions hold the potential to significantly advance our understanding of CLDN10 biology and its implications in health and disease.

What methodological advances would facilitate CLDN10 research?

Advancing CLDN10 research would benefit from several methodological innovations:

  • Improved Imaging Techniques:

    • Super-resolution microscopy to visualize CLDN10 organization within tight junction strands.

    • Live-cell imaging approaches to monitor CLDN10 dynamics during tight junction assembly and remodeling.

    • Correlative light and electron microscopy to link CLDN10 localization with ultrastructural features.

  • Advanced Protein Analysis:

    • Cross-linking mass spectrometry to identify interaction interfaces between CLDN10 and binding partners.

    • Hydrogen-deuterium exchange mass spectrometry to analyze conformational changes during channel formation.

    • Cryo-electron microscopy to determine the structure of CLDN10-containing tight junction complexes.

  • Functional Assays:

    • Development of high-throughput assays for measuring CLDN10-mediated paracellular ion transport.

    • Microfluidic systems to analyze epithelial barrier function in physiologically relevant conditions.

    • Organ-on-chip models incorporating CLDN10-expressing epithelia for drug screening and disease modeling.

  • Genetic Engineering:

    • CRISPR-Cas9 base editing for introducing specific CLDN10 mutations without disrupting the gene.

    • Inducible, tissue-specific gene modification systems for temporal control of CLDN10 expression.

    • Humanized mouse models expressing human CLDN10 variants for translational research.

These methodological advances would provide researchers with powerful tools to address key questions in CLDN10 biology and accelerate progress toward therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.