Recombinant Human Claudin-12 (CLDN12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
CLDN12; Claudin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CLDN12
Target Protein Sequence
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCAR YDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNI KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIA SAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVV SHTT
Uniprot No.

Target Background

Function
Recombinant Human Claudin-12 (CLDN12) plays a crucial role in tight junction formation, specifically mediating calcium-independent cell adhesion and obliteration of the intercellular space.
Gene References Into Functions
  1. CLDN12 expression may serve as a prognostic biomarker for survival in ER-negative breast cancer patients. PMID: 26926102
  2. Knockdown of claudin-3, claudin-4, and claudin-12 (but not claudin-1) enhanced breast cancer MCF-7 cell migration, with the most significant effect observed with claudin-12 siRNA. PMID: 25727011
  3. Differential claudin gene expression in colorectal cancer suggests a potential role for these tight junction proteins in tumorigenesis. PMID: 17047970
  4. Claudin-2 and/or claudin-12-based tight junctions appear to function as paracellular Ca(2+) channels in intestinal epithelia, contributing to vitamin D-dependent calcium homeostasis. PMID: 18287530
Database Links

HGNC: 2034

OMIM: 611232

KEGG: hsa:9069

STRING: 9606.ENSP00000287916

UniGene: Hs.731917

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of CLDN12 in tight junctions?

CLDN12 is a member of the claudin family of tight junction proteins that play crucial roles in maintaining epithelial and endothelial barrier integrity. Unlike some other claudins, CLDN12 has been specifically implicated in the regulation of paracellular permeability and has been found to be upregulated in certain cancer types, suggesting its role extends beyond basic barrier function. Research indicates that CLDN12 may participate in epithelial-mesenchymal transition (EMT), a process crucial for cancer metastasis, through interaction with signaling pathways such as the Tyk2/Stat1 pathway .

How does CLDN12 expression vary across tissue types?

CLDN12 shows tissue-specific expression patterns that differ from other claudin family members. Studies have demonstrated varied CLDN12 expression levels between normal lung epithelial tissues and lung cancer tissues, with significantly higher expression observed in squamous cell carcinoma (SqCC) compared to non-neoplastic lung epithelial tissues . This tissue-specific expression pattern suggests that CLDN12 may have specialized functions depending on the cellular context, which researchers should consider when designing experiments involving different cell types or tissues.

What genomic and protein structural features characterize CLDN12?

Human CLDN12 (GenBank accession number similar to NM022890 for CLDN1) encodes a four-transmembrane domain protein with intracellular N- and C-termini, similar to other claudin family members. The protein contains extracellular loops that participate in homophilic and heterophilic interactions, contributing to tight junction formation. When designing recombinant expression systems, researchers should consider preserving these structural features, potentially including a C-terminal tag (such as hexahistidine) for purification purposes, as has been successful with other claudin family members .

What expression systems are most effective for producing recombinant human CLDN12?

Based on successful approaches with other claudin family members, the methylotrophic yeast Pichia pastoris (X33 strain) provides an effective expression system for recombinant human CLDN12. This system offers advantages for membrane protein expression, including proper protein folding and post-translational modifications. The pPICZB vector under the control of the AOX1 promoter has proven effective for other claudins and would likely work for CLDN12 . The expression construct should include:

  • Full-length CLDN12 cDNA

  • C-terminal hexahistidine tag for purification

  • Appropriate selection markers (e.g., zeocin resistance)

The expression protocol should involve:

  • Transforming P. pastoris X33 cells with the CLDN12 expression construct

  • Selecting transformants on zeocin-containing media

  • Inducing expression with methanol

  • Harvesting cells and preparing membranes for protein extraction

What detergents are optimal for CLDN12 extraction and purification?

The choice of detergent significantly impacts the solubilization efficiency and structural integrity of membrane proteins like CLDN12. Based on studies with other claudins, the following detergents should be considered:

  • β-octylglucoside (βOG, 3%) - Preferred for biophysical studies and generally yields monodispersed protein

  • Foscholine-10 (3%) - Useful for extracting oligomeric forms of claudins

  • Profoldin-8 (3%) - Also effective for oligomeric extraction

Extraction protocol considerations:

  • Temperature: Perform extraction at 15°C

  • Duration: 1 hour for βOG, 16 hours for foscholine-10 or profoldin-8

  • Buffer composition: 10 mM MOPS pH 8.0 with appropriate detergent

What purification strategies yield highest purity recombinant CLDN12?

A two-step purification approach is recommended for recombinant CLDN12:

Step 1: Immobilized Metal Affinity Chromatography (IMAC)

  • Column: HisTrap HP sepharose

  • Binding buffer: 10 mM MOPS pH 8.0, 1% detergent, 20 mM imidazole

  • Elution buffer: 10 mM MOPS pH 8.0, 1% detergent, 500 mM imidazole

  • Flow rate: 0.5-1.0 mL/min

Step 2: Size Exclusion Chromatography (SEC)

  • Column: HiLoad Superdex S200

  • Running buffer: 10 mM MOPS pH 8.0, 1% detergent

  • Flow rate: 0.2 mL/min

  • Temperature: 10°C

This approach should yield approximately 0.3 mg of purified CLDN12 from 2 g wet weight of yeast membranes, based on yields observed with other claudin family members .

What biophysical methods are appropriate for characterizing recombinant CLDN12?

Several complementary biophysical techniques should be employed to comprehensively characterize recombinant CLDN12:

  • Analytical Ultracentrifugation (AUC)

    • Purpose: Determine oligomeric state and homogeneity

    • Key parameters: Sedimentation velocity and equilibrium experiments

    • Expected result: Monodispersed or oligomeric species depending on extraction method

  • SDS-PAGE Analysis

    • Purpose: Assess purity and apparent molecular weight

    • Methods: Both reducing and non-reducing conditions

    • Expected result: CLDN12 may appear as dimers (~48 kDa) under certain conditions, similar to observations with claudin-1

  • Circular Dichroism (CD) Spectroscopy

    • Purpose: Evaluate secondary structure content

    • Wavelength range: 190-260 nm

    • Expected result: High α-helical content typical of transmembrane proteins

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS)

    • Purpose: Determine absolute molecular weight and oligomeric state in solution

    • Expected result: Varies depending on detergent and extraction conditions

How can the functional integrity of recombinant CLDN12 be assessed?

The functional integrity of recombinant CLDN12 can be evaluated through various approaches:

  • Reconstitution into Proteoliposomes

    • Protocol: Mix purified CLDN12 with lipids at protein:lipid ratios of 1:100 to 1:1000 (w/w)

    • Detergent removal: Bio-Beads or dialysis

    • Confirmation methods: Dynamic light scattering and electron microscopy

  • Antibody Binding Assays

    • ELISA-based detection using anti-CLDN12 antibodies

    • Compare reactivity of purified protein versus membrane-embedded protein

    • Include proper controls (e.g., non-specific IgG)

  • Protein-Protein Interaction Studies

    • Techniques: Co-immunoprecipitation, surface plasmon resonance, or pull-down assays

    • Target interactions: Other tight junction proteins or signaling molecules

    • Controls: Include non-interacting membrane proteins

What methods can determine if recombinant CLDN12 forms proper oligomeric structures?

The oligomerization state of CLDN12 is crucial for its function and can be assessed through:

  • Native PAGE

    • Sample preparation: Non-denaturing conditions preserving oligomeric structures

    • Expected result: Multiple bands corresponding to monomers, dimers, or higher-order oligomers

  • Chemical Cross-linking

    • Reagents: BS3, DSS, or glutaraldehyde

    • Analysis: SDS-PAGE followed by Western blotting

    • Expected result: Ladder of bands representing different oligomeric species

  • Fluorescence Resonance Energy Transfer (FRET)

    • Approach: Label CLDN12 with fluorescent donor/acceptor pairs

    • Analysis: FRET efficiency as a measure of protein-protein proximity

    • Applications: Can be performed in reconstituted systems or cells expressing tagged CLDN12

These methods provide complementary information about the oligomeric behavior of CLDN12 under different conditions .

How can recombinant CLDN12 be used to study its role in cancer metastasis?

Recombinant CLDN12 provides valuable tools for investigating cancer metastasis mechanisms:

  • In vitro Migration and Invasion Assays

    • Transwell and wound-healing experiments using cells with modulated CLDN12 expression

    • Measure the impact of recombinant CLDN12 on cell migration capacity

    • Compare effects in normal versus cancer cell lines

  • EMT Marker Analysis

    • Western blotting and immunofluorescence to detect EMT markers (E-cadherin, N-cadherin, vimentin)

    • Assess how CLDN12 overexpression affects these markers

    • Identify potential signaling pathways involved (e.g., Tyk2/Stat1)

  • Binding Partner Identification

    • Use purified recombinant CLDN12 in pull-down assays to identify interacting proteins

    • Validate interactions in cell culture models

    • Map interaction domains through truncation or mutation experiments

Studies have shown that CLDN12 promotes EMT in human bronchial epithelial cells and is associated with lymphatic metastasis in SqCC patients, making these applications particularly relevant .

What experimental approaches can link CLDN12 expression to cancer progression?

Several approaches can establish the relationship between CLDN12 and cancer progression:

  • Plasmid-Based Expression Systems

    • Construct expression vectors (e.g., pNSE-IRES2-EGFP-CLDN12) for stable transfection

    • Select transformants using antibiotics (e.g., G418)

    • Establish monoclonal strains with confirmed CLDN12 expression

  • Cell Proliferation Assays

    • Use Cell Counting Kit-8 or similar assays to measure proliferation rates

    • Compare CLDN12-overexpressing cells with control cells

    • Analyze dose-dependent effects by varying expression levels

  • RNA Interference Studies

    • Design siRNAs targeting CLDN12 or associated signaling molecules (e.g., Tyk2)

    • Transfect cells and confirm knockdown efficiency

    • Assess impact on cancer-related phenotypes

  • Tissue Microarray Analysis

    • Compare CLDN12 expression in tumor versus normal tissues

    • Correlate expression levels with clinicopathological indicators

    • Perform survival analysis based on CLDN12 expression levels

How does CLDN12 interact with signaling pathways in cancer progression?

Research indicates that CLDN12 interacts with several signaling pathways relevant to cancer:

  • Tyk2/Stat1 Signaling Pathway

    • CLDN12 appears to activate the Tyk2/Stat1 pathway

    • This pathway regulates EMT in SqCC cells

    • RNA interference targeting Tyk2 can be used to assess the dependence of CLDN12-mediated effects on this pathway

  • EMT-Related Signaling

    • CLDN12 affects expression of epithelial markers like E-cadherin

    • Overexpression of CLDN12 promotes mesenchymal phenotype in epithelial cells

    • Western blotting and immunofluorescence can detect these changes

  • Experimental Approach: Pathway Inhibition Studies

    • Use specific inhibitors of signaling pathways (JAK/STAT, MAPK, PI3K)

    • Measure effects on CLDN12-mediated phenotypes

    • Combine with phosphoprotein analysis to map activation patterns

These approaches provide mechanistic insights into how CLDN12 contributes to cancer progression through specific signaling networks .

What are the optimal conditions for immunodetection of recombinant CLDN12?

Effective immunodetection of recombinant CLDN12 requires optimization of several parameters:

  • Western Blotting Protocol

    • Sample preparation: Include 4M urea in sample buffer to improve membrane protein solubilization

    • Gel percentage: 12-15% SDS-PAGE gels provide optimal resolution

    • Transfer conditions: Use PVDF membranes and methanol-free transfer buffer

    • Antibody selection: Anti-CLDN12 (commercial) and anti-His tag antibodies (for recombinant protein)

    • Blocking: 5% bovine serum albumin in PBS is recommended

  • Immunofluorescence Protocol

    • Fixation: 4% paraformaldehyde for 20 minutes at room temperature

    • Permeabilization: 0.1% Triton X-100 for tight junction proteins

    • Antibody dilution: Optimize through titration (typically 1:100 to 1:500)

    • Controls: Include isotype control antibodies and CLDN12-negative samples

  • ELISA-Based Detection

    • Coating concentration: Use purified protein at 1 μg/mL

    • Incubation: 4 hours at 37°C for optimal binding

    • Detection system: HRP-conjugated secondary antibodies with TMB substrate

    • Data analysis: Generate standard curves with purified protein

How can recombinant CLDN12 be used to develop functional barrier models?

Recombinant CLDN12 can be incorporated into various barrier models:

  • Proteoliposome-Based Models

    • Reconstitute purified CLDN12 into liposomes

    • Assess barrier properties through permeability assays

    • Measure size-selective and charge-selective permeability

  • Cell-Based Barrier Models

    • Transfect cells with CLDN12 expression constructs

    • Grow cells on permeable supports (Transwell systems)

    • Measure transepithelial/endothelial electrical resistance (TEER)

    • Assess paracellular flux using molecular tracers of various sizes

  • Co-Culture Systems

    • Combine CLDN12-expressing cells with other cell types

    • Create more physiologically relevant barrier models

    • Evaluate barrier response to stimuli or challenges

These models provide platforms for studying how CLDN12 contributes to barrier function in both physiological and pathological contexts .

What genetic approaches are effective for studying CLDN12 function?

Several genetic approaches can be employed to study CLDN12 function:

  • CRISPR/Cas9 Gene Editing

    • Design guide RNAs targeting the CLDN12 gene

    • Generate knockout cell lines or animal models

    • Validate edits through sequencing and protein expression analysis

    • Assess phenotypic consequences including barrier properties and cancer-related phenotypes

  • Site-Directed Mutagenesis

    • Create specific mutations in CLDN12 coding sequence

    • Focus on conserved residues or disease-associated variants

    • Express mutant proteins and assess functional consequences

    • Map structure-function relationships

  • Conditional Expression Systems

    • Use inducible promoters (e.g., tetracycline-responsive)

    • Allow temporal control of CLDN12 expression

    • Study acute versus chronic effects of CLDN12 modulation

  • Tissue-Specific Transgenic Models

    • Generate animal models with tissue-specific CLDN12 expression or deletion

    • Evaluate physiological consequences in relevant tissues

    • Assess implications for disease processes

Global CLDN12 knockout mice have demonstrated important phenotypes including nerve barrier breakdown, highlighting the value of genetic approaches in understanding CLDN12 function in vivo .

How can yield and solubility issues with recombinant CLDN12 be addressed?

Membrane proteins like CLDN12 often present challenges in recombinant expression:

  • Optimization Strategies for Increased Yield

    • Adjust induction conditions (temperature, inducer concentration, duration)

    • Test different host strains or expression systems

    • Optimize codon usage for the expression host

    • Consider fusion partners to enhance expression

  • Addressing Solubility Issues

    • Screen additional detergents (DDM, LMNG, CHAPS)

    • Test detergent combinations or detergent:lipid mixtures

    • Adjust extraction conditions (temperature, salt concentration, pH)

    • Consider nanodiscs or amphipols as alternatives to detergents

  • Stabilization Approaches

    • Include specific lipids during purification

    • Add stabilizing agents (glycerol, specific ions)

    • Consider protein engineering to improve stability

These approaches can significantly improve the yield and quality of recombinant CLDN12 preparations .

How can aggregation of purified CLDN12 be prevented?

Preventing aggregation is crucial for maintaining functional recombinant CLDN12:

  • Storage Conditions

    • Temperature: Store at 4°C for short term, -80°C for long term

    • Buffer composition: Include glycerol (10-20%) as cryoprotectant

    • Aliquoting: Prepare single-use aliquots to avoid freeze-thaw cycles

  • Formulation Optimization

    • Detergent concentration: Maintain above critical micelle concentration

    • pH optimization: Test range 6.5-8.5 for optimal stability

    • Salt concentration: Typically 150-300 mM NaCl or KCl

    • Addition of specific lipids: POPC, POPE, or cholesterol at 10-20% w/w

  • Quality Control Methods

    • DLS to monitor size distribution over time

    • SEC to assess monodispersity

    • Functional assays to confirm activity retention

Implementing these practices can significantly extend the usable lifetime of purified CLDN12 preparations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.