Recombinant Human Claudin-15 (CLDN15)

Shipped with Ice Packs
In Stock
Cat. No.
BT2137075
Source
in vitro E.coli expression system
Synonyms
CLDN15; Claudin-15
Quick Inquiry

Description

Definition and Biological Role

Claudin-15 is a member of the claudin family, integral membrane proteins that form the backbone of tight junctions. These junctions regulate paracellular permeability, maintain cell polarity, and participate in immune cell transmigration . Recombinant CLDN15 is produced via heterologous expression systems to mimic its native structure and function, enabling precise experimental control over its expression levels and localization .

Experimental Applications

Recombinant CLDN15 is employed in diverse research contexts:

Cellular Function Studies

In Schwann cell models, overexpression of CLDN15 via plasmid transfection (pGV230-Claudin-15) demonstrated:

  • Inhibited Proliferation: Reduced EdU incorporation compared to controls .

  • Promoted Apoptosis: Increased apoptotic rates (flow cytometry) and elevated Bax expression .

  • Modulated Neurotrophins: Upregulated basic fibroblast growth factor (bFGF) and neurotrophin-3 (NT3) .

Detection and Analysis

Antibodies like Mouse Anti-Human Claudin-15 Monoclonal Antibody (MAB10344) enable precise detection via:

  • Flow Cytometry: Validated in HEK293 cells transfected with CLDN15 .

  • Immunohistochemistry (IHC): Used to assess tissue-specific expression .

Therapeutic and Diagnostic Potential

While CLDN15 itself is not yet a clinical target, insights from related claudins (e.g., CLDN6, CLDN18.2) highlight potential therapeutic pathways:

  • Antibody-Drug Conjugates (ADCs): CLDN18.2-targeted ADCs showed efficacy in pancreatic and gastric cancer xenografts .

  • CAR-T Cell Therapy: CLDN6-targeted CAR-T cells achieved partial responses in refractory solid tumors .

CLDN15’s role in Schwann cell apoptosis suggests potential applications in nerve regeneration studies, though no clinical trials are currently documented .

Table 2: Functional Outcomes of CLDN15 Modulation in Schwann Cells

ParameterCLDN15 OverexpressionCLDN15 Knockdown
Proliferation↓ (EdU assay)↑ (EdU assay)
Apoptosis↑ (Flow cytometry)↓ (Flow cytometry)
bFGF/NT3 Expression↑↑

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CLDN15; Claudin-15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CLDN15
Target Protein Sequence
MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVY NCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA GALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLC SACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Uniprot No.
P56746

Target Background

Function
Claudins are integral components of tight junction complexes that regulate epithelial permeability. While some claudins function as impermeable barriers, others facilitate the paracellular transport of ions and small molecules. The co-expression and interaction of multiple claudins determine overall permeability. CLDN15 forms tight junctions mediating paracellular transport of small monovalent cations along concentration gradients, exhibiting selective permeability for Na+, Li+, and K+ ions, while excluding Cl- ions. It plays a crucial role in intestinal paracellular Na+ transport and Na+ homeostasis, and is essential for normal Na+-dependent intestinal nutrient absorption.
Gene References Into Functions
  1. Analysis of claudin-15 tight junction paracellular architecture by molecular dynamics simulations. PMID: 28863193
  2. Alterations in myosin light chain kinase activity, and claudin-15 and claudin-2 expression are associated with gluten-induced symptomatology and intestinal permeability changes in diarrhea-predominant irritable bowel syndrome (IBS-D). PMID: 27869798
Database Links

HGNC: 2036

OMIM: 615778

KEGG: hsa:24146

STRING: 9606.ENSP00000308870

UniGene: Hs.38738

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. Note=Tight junctions form continuous circumferential cell-cell contacts at the borders of apical and lateral cell membranes that seal the intercellular space and show up as strand-like structures in electron microscopy.
Tissue Specificity
Detected in colon (at protein level).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.