Recombinant Human Claudin-19 (CLDN19)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Claudin-19 (CLDN19)

Recombinant Human Claudin-19 (CLDN19) is a protein encoded by the CLDN19 gene, belonging to the claudin family of transmembrane proteins. Claudin-19 plays a crucial role in forming tight junctions, which are essential for maintaining epithelial barrier function and controlling the passage of ions and molecules across epithelial sheets . This protein is particularly significant in renal tubules and the retina, where it is highly expressed .

Biological Functions of Claudin-19

Claudin-19 is involved in several biological processes:

  • Magnesium Transport: It has been implicated in magnesium transport, which is vital for maintaining proper electrolyte balance in the body .

  • Tight Junction Formation: Claudin-19 contributes to the formation and maintenance of tight junctions, ensuring the integrity of epithelial barriers .

  • Retinal Function: It plays a role in the development and function of the retina, particularly in the retinal pigment epithelium (RPE), affecting visual cycle proteins and retinal neurotrophic factors .

Mutations and Associated Diseases

Mutations in the CLDN19 gene are associated with several diseases:

  • Hypomagnesemia with Renal Failure and Ocular Abnormalities: Mutations in CLDN19 can lead to hypomagnesemia, renal failure, and severe ocular abnormalities due to disrupted tight junction function .

  • Familial Hypomagnesemia with Hypercalciuria and Nephrocalcinosis (FHHNC): This condition is characterized by renal magnesium wasting and often involves mutations in CLDN19 or CLDN16 .

Table: Mutations in CLDN19 and Associated Diseases

MutationDisease AssociationReferences
G20DFHHNC, Hypomagnesemia
R81WRetinal Abnormalities
Q57EFHHNC
I41TFHHNC
G75CFHHNC
G75SFHHNC
G122RFHHNC

Research Findings

Recent studies have highlighted the importance of claudin-19 in maintaining epithelial barrier function and its role in disease pathogenesis:

  • Expression in RPE Cells: Claudin-19 is predominantly expressed in retinal pigment epithelial cells and is crucial for maintaining the integrity of tight junctions in these cells .

  • Impact of Mutations: Mutations in CLDN19 can disrupt tight junction function, leading to severe ocular and renal abnormalities .

Applications of Recombinant Human Claudin-19

Recombinant Human Claudin-19 can be used in various research applications:

  • Cell Culture Studies: To study the role of claudin-19 in tight junction formation and function in epithelial cells.

  • Disease Modeling: For modeling diseases associated with CLDN19 mutations, such as FHHNC and ocular abnormalities.

  • Therapeutic Development: As a potential target for developing treatments for conditions related to disrupted tight junctions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its development.
Synonyms
CLDN19; Claudin-19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CLDN19
Target Protein Sequence
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAI AGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGS FLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
Uniprot No.

Target Background

Function
Claudin-19 plays a critical role in tight junction-specific obliteration of the intercellular space. This function is mediated through calcium-independent cell-adhesion activity.
Gene References Into Functions
  1. Claudin-19 contributes to permeability barriers and influences cell morphology, proliferation, migration, AKT signaling, and gene expression. When claudins are exogenously expressed, ARPE-19 cells more closely model native retinal pigment epithelium. PMID: 27593915
  2. Mutations in the CLDN19 gene are responsible for familial magnesium deficiency with hypercalciuria and nephrocalcinosis. PMID: 25410674
  3. Research has identified a novel mutation (c.241C>T in exon 2 of CLDN19) in a Chinese patient. PMID: 25555744
  4. Claudin-19, the most abundant claudin in myelin, has been shown to exhibit no binding to ZO2 protein. PMID: 25712527
  5. Patients with CLDN19 mutations are at an increased risk of progressing to chronic renal disease. PMID: 23301036
  6. Case reports have documented novel CLDN19 mutations in familial hypomagnesemia with hypercalciuria and nephrocalcinosis. PMID: 23538362
  7. The risk of end-stage renal disease in patients with CLDN19 mutations is twice as high as in patients with CLDN16 mutations. Notably, ocular abnormalities have been observed exclusively in patients with CLDN19 mutations. PMID: 22422540
  8. In a patient with consanguineous parents and a history of disrupted retinal organization and development, a diagnosis of Familial hypomagnesemia with hypercalciuria and nephrocalcinosis caused by a claudin-19 mutation should be considered. PMID: 22734304
  9. Ocular manifestations and exercise intolerance mimicking mild to moderate periodic paralysis are two symptoms that may occur in patients with familial hypomagnesemia with hypercalciuria and nephrocalcinosis and may indicate CLDN19 mutations. PMID: 21030577
  10. The identification of CLDN19 mutations in patients with chronic renal failure and severe visual impairment underscores the fundamental role of claudin-19 in maintaining normal renal tubular function and undisturbed organization and development of the retina. PMID: 17033971

Show More

Hide All

Database Links

HGNC: 2040

OMIM: 248190

KEGG: hsa:149461

STRING: 9606.ENSP00000296387

UniGene: Hs.496270

Involvement In Disease
Hypomagnesemia 5 (HOMG5)
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is the tissue-specific expression pattern of CLDN19 during development?

CLDN19 demonstrates distinct developmental expression patterns across tissues. In mouse models, CLDN19 mRNA is detected in both retinal pigment epithelium (RPE) and developing neurosensory retina at birth (postnatal day 0). In RPE, CLDN19 expression increases approximately 4-fold after postnatal day 3 and continues to be expressed through adulthood. Conversely, in the neurosensory retina, CLDN19 expression decreases after postnatal day 14 and becomes undetectable by postnatal day 30 .

Immunofluorescence studies reveal that CLDN19 is initially expressed throughout retinal precursors at postnatal day 0. By postnatal day 3, CLDN19 becomes restricted to the ganglion cell layer. In mature RPE, CLDN19 localizes to a circumferential band at the apical end of the lateral plasma membrane, where it co-localizes with ZO-1, a structural protein of tight junctions .

How does CLDN19 function in tight junction assembly?

CLDN19 plays a critical role in tight junction assembly through its interaction with other claudin family members, particularly claudin-16 (CLDN16). Studies demonstrate that heteromeric interaction between CLDN16 and CLDN19 is required for their proper assembly into tight junction structures and for generating cation-selective paracellular channels .

In the thick ascending limb (TAL) of the kidney, siRNA knockdown of CLDN19 causes loss of CLDN16 from tight junctions without decreasing CLDN16 expression levels. Similarly, knockdown of CLDN16 produces a comparable effect on CLDN19 localization. Importantly, other tight junction components such as CLDN10, CLDN18, occludin, and ZO-1 remain correctly localized in both knockdown models, suggesting a specific heteromeric interaction between CLDN16 and CLDN19 .

Yeast two-hybrid binding studies confirm this interaction, with CLDN16 and CLDN19 showing stronger affinity for each other than for other claudins like CLDN10 or CLDN18. This heteromeric complex is essential for proper tight junction function, particularly in maintaining cation selectivity in paracellular transport .

What are the primary effects of disease-associated CLDN19 mutations on protein localization and function?

Disease-associated mutations in CLDN19, such as G20D and R81W, significantly disrupt protein localization and function in multiple experimental models. In human induced pluripotent stem cells, CLDN19 mutations affect retinal neurogenesis and maturation of retinal pigment epithelium. When these mutations are overexpressed in mouse retinae, they diminish the P1 wave of the electroretinogram, activate apoptosis in the outer nuclear layer, and alter the morphology of bipolar cells .

At the cellular level, while wild-type human CLDN19 properly localizes to the lateral membranes of RPE cells with minimal presence in internal vesicles, both CLDN19 G20D and CLDN19 R81W mutants mislocalize primarily to internal compartments. This mislocalization impacts tight junction formation and function .

When co-expressed with wild-type CLDN19 tagged with RFP, the G20D mutant sequesters the wild-type protein in internal vesicular compartments, with only weak signal of wild-type CLDN19 observed in tight junctions. The R81W mutation shows a milder phenotype, with partial co-localization with wild-type CLDN19 at lateral membranes, though a significant portion remains in internal vesicles .

How do CLDN19 mutations affect gene expression in retinal pigment epithelium (RPE)?

CLDN19 mutations significantly alter the expression of RPE signature genes, which includes visual cycle proteins and retinal neurotrophic factors. In human fetal RPE cultures, the G20D mutation downregulates a subset of signature genes including FRZB, MMP2, PEDF, PMEL1, RPE65, and TTR .

Studies using the ARPE-19 cell line, which lacks endogenous CLDN19 expression, demonstrate that wild-type CLDN19 upregulates several RPE signature genes, including BEST1, NGF, PEDF, RPE65, SIX3, SFRP5, and TTR. In contrast, mutant forms of CLDN19 (G20D and R81W) fail to upregulate these genes, particularly NGF, PEDF, and RPE65 .

Importantly, the downregulation of RPE65 appears to be a critical disease-causing effect of CLDN19 mutations, as it leads to defective visual cycle function. This effect can be partially rescued by administration of 9-cis-retinal, which helps counter the loss of retinal isomerase activity in mouse models .

What are the optimal experimental models for studying CLDN19 function and disease mechanisms?

Multiple complementary experimental models have been developed to study CLDN19 function and disease mechanisms, each with specific advantages:

  • Human induced pluripotent stem cells (iPSCs): Using CRISPR/Cas9 technology to introduce specific mutations (e.g., G20D) in CLDN19 allows investigation of how pathology develops during differentiation of human retinal cells in vitro. This approach is particularly valuable for studying developmental effects of CLDN19 mutations on retinal neurogenesis and RPE maturation .

  • In vivo mouse models: Overexpression of mutant CLDN19 (G20D, R81W) in the retina of mouse pups or siRNA knockdown of CLDN19 enables analysis of functional consequences on visual processing and cellular organization. These models demonstrate phenotypes such as diminished electroretinogram responses, altered retinal cell morphology, and systemic effects like renal magnesium and calcium wasting .

  • RPE cell culture models: Two approaches have been used:

    • Human fetal RPE primary cultures for studying effects on gene expression

    • ARPE-19 cell line (which lacks endogenous CLDN19) for exogenous expression of wild-type or mutant CLDN19 to study localization and gene regulation effects

  • Yeast two-hybrid system: Valuable for analyzing protein-protein interactions between CLDN19 and other claudins, using reporter genes (HIS3, lacZ, and ADE2) to quantify interaction strength .

Each model system offers distinct insights, from molecular interactions to tissue-level consequences, making a multi-model approach optimal for comprehensive understanding of CLDN19 biology.

What methods are most effective for analyzing CLDN19 localization and trafficking in epithelial cells?

For effective analysis of CLDN19 localization and trafficking in epithelial cells, researchers should employ a combination of complementary techniques:

  • Fluorescent protein tagging: Adding fluorescent tags (such as RFP) to the N-terminus of CLDN19 allows real-time visualization of protein trafficking and localization. This approach has successfully demonstrated differences between wild-type and mutant CLDN19 localization patterns .

  • Epitope tagging: Using small epitope tags (Flag, HA) enables co-expression studies with differently tagged CLDN19 variants to analyze their interactions and co-localization. This approach revealed how mutant CLDN19 affects wild-type protein localization .

  • Indirect immunofluorescence: Using specific antibodies against CLDN19 and other tight junction proteins (such as ZO-1) allows visualization of native protein expression patterns in tissue sections and cell cultures. This technique has been used to track developmental expression patterns in mouse retina .

  • Co-localization analysis: Quantitative analysis of fluorescent signal overlap between CLDN19 and other proteins helps determine the extent of protein interactions at tight junctions versus internal compartments. Whitish magenta signal, for example, indicates differing ratios of wild-type and mutant protein in specific cellular compartments .

When implementing these techniques, it's important to consider fixation conditions that preserve tight junction structures, appropriate controls for antibody specificity, and quantitative methods for analyzing co-localization patterns.

How can recombinant CLDN19 be used to investigate heteromeric claudin interactions in tight junction assembly?

Recombinant CLDN19 provides a powerful tool for investigating heteromeric claudin interactions in tight junction assembly through several sophisticated approaches:

  • Differential tagging strategies: By engineering recombinant CLDN19 constructs with different epitope tags (e.g., RFP-CLDN19 WT with HA-CLDN19 mutants), researchers can precisely track the localization and interaction patterns between wild-type and mutant proteins, or between CLDN19 and other claudin family members. This approach revealed that CLDN19 G20D sequesters wild-type CLDN19 in internal vesicular compartments, while R81W allows partial membrane localization .

  • Yeast two-hybrid (Y2H) binding assays: Using recombinant CLDN19 as bait in Y2H systems with reporter genes (HIS3, lacZ, and ADE2) enables quantitative assessment of interaction affinities with other claudins. This methodology has demonstrated stronger interactions between CLDN19 and CLDN16 compared to CLDN19 interactions with CLDN10 or CLDN18 .

  • Mutational analysis: Introducing specific mutations in recombinant CLDN19 (G20D, Q57E, L90P, and G123R) allows determination of critical residues for heteromeric interactions. Interestingly, these mutations disrupt CLDN19-CLDN16 interactions but not CLDN19-CLDN18 interactions, suggesting distinct binding interfaces for different claudin partners .

  • Functional reconstitution: Expressing recombinant CLDN19 in claudin-deficient cell lines enables researchers to reconstruct functional tight junctions and assess the contribution of specific claudin combinations to barrier properties and ion selectivity .

These approaches collectively provide insights into the hierarchical assembly process of tight junctions and help resolve apparent conflicts between in vitro binding data and in vivo observations of claudin distribution patterns.

What strategies can overcome challenges in expressing and purifying functional recombinant CLDN19 for structural studies?

Expressing and purifying functional recombinant CLDN19 for structural studies presents several challenges due to its multiple transmembrane domains and complex folding requirements. Effective strategies include:

By combining these approaches, researchers can overcome the inherent difficulties in working with multi-pass membrane proteins like CLDN19, enabling structural investigations that complement functional studies.

How can recombinant CLDN19 be used to develop therapeutic approaches for FHHNC-associated ocular disease?

Recombinant CLDN19 provides several promising avenues for developing therapeutic approaches for Familial Hypomagnesaemia with Hypercalciuria, Nephrocalcinosis (FHHNC)-associated ocular disease:

  • Gene therapy vectors: Recombinant CLDN19 can be incorporated into adeno-associated virus (AAV) vectors for localized gene delivery to the retinal pigment epithelium. This approach could potentially restore proper CLDN19 function in patients with mutations, similar to strategies used for overexpression studies in mouse models .

  • RPE65 supplementation: Since a critical disease-causing effect of CLDN19 mutations is downregulation of RPE65 and consequent defects in the visual cycle, therapeutic approaches targeting RPE65 expression or function represent a promising strategy. The partial restoration of visual function in mice treated with 9-cis-retinal supports this approach .

  • Small molecule screening: Recombinant CLDN19 can be used in high-throughput screens to identify small molecules that stabilize mutant CLDN19 proteins and facilitate their proper trafficking to tight junctions. This approach could potentially restore function to missense mutations like G20D and R81W that primarily affect protein localization .

  • Peptide mimetics: Based on structural insights from CLDN19-CLDN16 interaction studies, peptide mimetics could be designed to enhance the assembly and stability of tight junction complexes, potentially compensating for defective claudin function.

  • Targeted upregulation of RPE signature genes: Since wild-type CLDN19 upregulates multiple RPE signature genes (BEST1, NGF, PEDF, RPE65, SIX3, SFRP5, and TTR), therapeutic approaches could target downstream pathways to restore expression of these critical factors independent of CLDN19 function .

These approaches focus specifically on the ocular manifestations of FHHNC, which can be studied independently from renal effects in appropriate model systems.

What functional assays best capture the impact of CLDN19 mutations on paracellular ion selectivity?

Effective functional assays for measuring the impact of CLDN19 mutations on paracellular ion selectivity include:

  • Transepithelial electrical resistance (TEER): This technique measures the electrical resistance across an epithelial monolayer, providing a quantitative assessment of tight junction barrier function. Studies of CLDN19 knockdown in thick ascending limb (TAL) cells demonstrated that while CLDN19-depleted tight junctions maintained normal barrier function (similar TEER values), they exhibited defective ion selectivity .

  • Dilution potential measurements: These assays involve creating an ionic gradient across the epithelial monolayer and measuring the resulting electrical potential. This approach directly quantifies the selective permeability of the paracellular pathway to specific ions (such as Na+, K+, Mg2+, and Ca2+), revealing how CLDN19 mutations alter ion selectivity .

  • Isotope flux assays: Using radioactive or stable isotopes of specific ions (particularly Mg2+ and Ca2+) allows direct measurement of ion transport rates across epithelial monolayers. These assays can detect subtle changes in ion selectivity that might not be apparent in electrical measurements.

  • In vivo electrolyte analyses: Complementing in vitro approaches, analysis of plasma and urinary electrolytes in animal models provides physiologically relevant data on the consequences of CLDN19 dysfunction. CLDN19 knockdown mice exhibit hypomagnesemia and hypercalciuria similar to human FHHNC patients, with specific alterations in fractional excretion of Mg2+ and Ca2+ .

  • Ussing chamber studies: This technique enables simultaneous measurement of electrical parameters and ion fluxes across epithelial tissues or cell monolayers, providing comprehensive data on paracellular transport properties.

When interpreting these assays, it's important to consider that CLDN19 functions in heteromeric complexes, particularly with CLDN16. The most informative experimental designs will examine how CLDN19 mutations affect the function of these complexes rather than CLDN19 in isolation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.