Recombinant Human Claudin-2 (CLDN2)

Shipped with Ice Packs
In Stock

Description

Mechanistic Studies of Tight Junctions

Recombinant CLDN2 is used to investigate paracellular transport. For example:

  • Cation Selectivity: CLDN2 forms channels permeable to Na⁺ and Ca²⁺, critical for renal and intestinal ion homeostasis .

  • Water Transport: In intestinal epithelia, CLDN2-mediated water flux aids nutrient absorption and mucosal immunity .

Disease Modeling

  • Colorectal Cancer (CRC): Elevated CLDN2 expression correlates with tumor growth and metastasis. Recombinant CLDN2 enabled identification of its interaction with ZO1/ZONAB complexes, which suppress the metastasis inhibitor NDRG1 .

  • Inflammatory Bowel Disease (IBD): CLDN2 overexpression exacerbates intestinal permeability, but paradoxically promotes mucosal healing via EGFR signaling, reducing colitis-associated cancer risk .

Diagnostic Development

  • ELISA Kits: Detect CLDN2 in serum, plasma, and tissue homogenates with a sensitivity of 5.86 pg/mL and a linear range of 23.5–1500 pg/mL .

ELISA PerformanceData
Recovery in Serum100–109% (Avg: 104%)
Recovery in EDTA Plasma90–101% (Avg: 96%)

CRC Metastasis Mechanisms (Wei et al., 2021)

  • Methods: CLDN2 knockout in HT29 CRC cells using CRISPR-Cas9.

  • Findings: CLDN2 depletion increased NDRG1 expression, reducing tumor proliferation and metastasis. Recombinant CLDN2 restored ZONAB nuclear translocation, confirming its role in oncogenic signaling .

Pre-Diabetes Biomarker Discovery (Songtao et al., 2024)

  • Methods: Analyzed CLDN2 levels in high-fat diet (HFD) and streptozotocin (STZ)-induced diabetic mice.

  • Findings: CLDN2 was upregulated in pre-diabetic and diabetic models, correlating with insulin resistance .

Challenges and Future Directions

  • Therapeutic Targeting: CLDN2’s dual role in promoting mucosal healing and cancer complicates drug development .

  • Biomarker Validation: Further clinical trials are needed to confirm CLDN2’s utility in pre-diabetes diagnosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its use.
Synonyms
CLDN2; PSEC0059; SP82; UNQ705/PRO1356; Claudin-2; SP82
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CLDN2
Target Protein Sequence
MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTG ITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVA GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGII LCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Uniprot No.

Target Background

Function
Claudin-2 plays a crucial role in the calcium-independent cell adhesion that obliterates the intercellular space in tight junctions.
Gene References Into Functions

Claudin-2 Function and Associated Research:

  1. CLDN2's role in regulating tissue-specific physiological properties of tight junctions in ulcerative colitis (UC). PMID: 29040430
  2. Claudin-2 knockdown enhances accumulation of doxorubicin (DXR) in lung adenocarcinoma spheroids, reducing cell viability. This suggests claudin-2 as a potential therapeutic target due to its influence on anticancer agent accumulation. PMID: 29247669
  3. The integrated function of claudin-2, occludin, and ZO-1 is essential for maintaining the proximal tubular epithelium's integrity. PMID: 29252987
  4. Butyrate's promotion of intestinal barrier function involves IL-10RA-dependent repression of claudin-2. PMID: 28893958
  5. Low CLDN2 expression correlates with lung cancer metastasis. PMID: 28754672
  6. IL-22 increases intestinal epithelial permeability by upregulating Claudin-2 expression through the JAK/STAT pathway. PMID: 28939759
  7. TCPTP protects the intestinal epithelial barrier by limiting STAT-induced claudin-2 expression. PMID: 28804910
  8. Claudin-2, a cation channel-forming tight junction protein, facilitates paracellular water passage. PMID: 28636801
  9. Epigenetic inhibitors suppress the proliferation of claudin-2-overexpressing lung adenocarcinoma cells. PMID: 28057758
  10. Changes in myosin light chain kinase activity and claudin-15 and -2 expression are associated with gluten-induced symptoms and intestinal permeability changes in diarrhea-predominant irritable bowel syndrome (IBS-D). PMID: 27869798
  11. Hypotonic stress triggers dephosphorylation, clathrin-dependent endocytosis, and lysosomal degradation of claudin-1 and -2, disrupting the tight junction barrier in renal tubular epithelial cells. PMID: 27733684
  12. Claudin-2 expression increases in TNF-alpha treated Caco-2 cell monolayers. PMID: 28106723
  13. Claudin-2 forms gated paracellular channels. PMID: 26568313
  14. The claudin2 (rs7057398) polymorphism is associated with idiopathic recurrent acute pancreatitis and its progression to chronic pancreatitis. PMID: 26110235
  15. Genetic variants in CLDN2 and MORC4 genes are associated with chronic pancreatitis in Indian patients. PMID: 26820620
  16. Quercetin reduces claudin-2 expression by upregulating miR-16 expression and destabilizing claudin-2 mRNA in lung adenocarcinoma cells. PMID: 26061016
  17. Pan-inhibition of SFK signaling pathways increases Claudin-2 expression in breast cancer cells. Yes or Fyn loss induces Claudin-2 expression, while reduced Lyn levels impair Claudin-2 expression. PMID: 25823815
  18. PKCiota binds to Rab14 and requires it for proper cellular distribution. Like Rab14, PKCiota protects claudin-2 from lysosomal degradation, modulating the epithelial barrier. PMID: 25694446
  19. Claudin-1 and -2 tyrosine phosphorylation regulates their interaction with ZO1. PMID: 26023235
  20. A single nucleotide polymorphism is associated with alcoholic pancreatitis. PMID: 25253127
  21. TNF-alpha modifies claudin-2 expression in tubular cells, impacting transport and barrier function. PMID: 25948735
  22. Claudin-5 overexpression promotes claudin-1 and -2 interactions, enhancing retinal cell barrier function. PMID: 25323998
  23. Claudins 2 and 4 have reciprocal effects on epithelial barrier function, exhibit different FRAP dynamics, and compete for tight junction residency. PMID: 25031428
  24. Autophagy reduces paracellular permeability by degrading claudin-2. PMID: 25616664
  25. Reduced claudin-2 enhances endothelial barrier function, potentially contributing to prolonged survival in patients with Kaposi sarcoma-associated herpesvirus and HIV co-infection. PMID: 24995964
  26. IL-6's modulation of intestinal TJ permeability is regulated by JNK activation of AP-1 and AP-1 activation of claudin-2. PMID: 24662742
  27. Claudin-2 is involved in paracellular water transport and its expression is sensitive to compound-induced cellular stress. PMID: 24907557
  28. Claudin-2 expression is downregulated in gastric cancer tissue. PMID: 23919729
  29. In breast cancer patients, CLDN2 is significantly upregulated in liver metastases compared to other metastatic sites. PMID: 24287398
  30. Claudin-2 knockdown decreases A549 cell proliferation and reduces the percentage of cells in the S phase. PMID: 24907662
  31. Altered claudin-1 expression is observed in comparing normal skin to actinic keratosis and squamous cell carcinoma of the skin. PMID: 24294371
  32. Helicobacter pylori-induced tumorigenesis and invasiveness in gastric carcinoma cells is mediated by bacterial CagA via Cdx2-dependent targeting of Claudin-2. PMID: 24287273
  33. A variant in the CLDN2-MORC4 region is associated with Crohn's disease in a Swedish population. PMID: 23946598
  34. Bovine colostrum elevates claudin-2 expression in intestinal epithelia without altering ion permeability. PMID: 23717570
  35. The Y67L mutant of claudin-2 shows reduced cation selectivity compared to wild-type due to decreased Na(+) permeability without affecting Cl(-) permeability. PMID: 23760508
  36. Claudin-2 plays a significant role in colorectal inflammation, implicating MLCK in colon inflammation. PMID: 23306855
  37. Sinonasal epithelium in allergic fungal rhinosinusitis shows increased epithelial permeability and altered claudin-2 expression. PMID: 22927233
  38. Pericryptal myofibroblast-derived paracrine KGF and largely autocrine amphiregulin upregulate claudin-2 in Caco-2 monolayers, disrupting tight junction integrity. PMID: 22946653
  39. Genome-wide studies identified associations with alcoholic pancreatitis at PRSS1-PRSS2 and X-linked CLDN2. PMID: 23143602
  40. A549 cells secrete EGF via MMP, increasing claudin-2 expression through the EGFR/MEK/ERK pathway. PMID: 22546605
  41. Claudin-2 is highly expressed in the ileum of patients with Crohn's disease, both in quiescent and active phases. PMID: 21688348
  42. Breast cancer cells with PIK3CA mutations show selective sensitivity to mTOR inhibitors, while cells with PTEN loss of function do not. PMID: 21383692
  43. CLDN2 is enriched in and promotes breast cancer liver metastases. PMID: 21076473
  44. Claudin-2 and SYN1 enhance microbial translocation across the intestinal barrier, contributing to immune activation and CD4 T-cell depletion in HIV-1 infection. PMID: 20700059
  45. Claudin-2 is not expressed in Epstein-Barr virus-associated nasopharyngeal carcinoma. PMID: 20204275
  46. CLDN 2 expression is significantly increased in severe celiac disease in the bulb and distal duodenum. PMID: 20143085
  47. The human claudin-2 promoter is TATA-less, with conserved binding sites for caudal-related homeodomain proteins and hepatocyte nuclear factor-1alpha. PMID: 11934881
  48. Claudins 2 and 4 form paracellular channels, with the first extracellular domain determining charge selectivity and transepithelial electrical resistance. PMID: 12700140
  49. Claudin-2 contributes to paracellular barrier function by creating pores for small cations. PMID: 14751232
  50. Optimal claudin-2 expression in the gut depends on GATA-4, suggesting its role in intestinal regionalization. PMID: 15389642
Database Links

HGNC: 2041

OMIM: 300520

KEGG: hsa:9075

STRING: 9606.ENSP00000336571

UniGene: Hs.522746

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Claudin-2 in human epithelial and endothelial cells?

Claudin-2 is a crucial transmembrane protein within the Claudin family that forms and maintains tight junctions in epithelial and endothelial cells. Its distinctive characteristic is the ability to form channels that selectively permit the passage of small cations, particularly sodium ions, thereby contributing to ion balance regulation and homeostasis across various tissues. This selective permeability function is essential for maintaining proper barrier function while allowing necessary paracellular transport. In experimental settings, loss of Claudin-2 has been shown to increase cellular permeability approximately 1.5-fold compared to control conditions, highlighting its role in regulating epithelial barrier integrity .

What detection methods are most effective for quantifying Claudin-2 expression in tissue samples?

For robust detection of Claudin-2 in research settings, multiple approaches can be utilized:

  • In situ hybridization (ISH): A validated approach for detecting claudin-2 mRNA in formalin-fixed tissue samples. This method has undergone tiered validation making it suitable for clinical deployment and offers high specificity for examining expression patterns in intact tissue architecture .

  • Western blot analysis: Effective for quantifying total Claudin-2 protein levels in tissue lysates. When implementing this approach, researchers should carefully validate antibodies as published antibodies may not correctly identify the intended antigen in formalin-fixed tissues .

  • Flow cytometry: Useful for assessing Claudin-2 expression in cellular populations and can be combined with other markers to perform correlative analyses.

  • Real-time PCR: Enables quantification of Claudin-2 mRNA expression levels and can be particularly valuable when protein detection proves challenging.

When selecting a method, consideration of sample preparation, fixation protocols, and availability of validated reagents is critical for generating reliable and reproducible results.

How does Claudin-2 expression change in inflammatory conditions?

In inflammatory conditions, particularly inflammatory bowel diseases like ulcerative colitis, Claudin-2 expression is significantly upregulated. This upregulation correlates with disease severity in samples that retain crypt morphology, making it a potential biomarker for disease progression. Cytokines present in the inflammatory microenvironment appear to drive this increased expression. Interestingly, the correlation between Claudin-2 levels and disease severity is not observed in samples with the highest Geboes scores (indicating severe inflammation), likely due to extensive crypt destruction in these tissues .

The dysregulation of Claudin-2 expression contributes to altered permeability and barrier dysfunction, which may exacerbate inflammatory conditions. This pattern of expression makes Claudin-2 not only a marker of inflammation but potentially a mechanistic contributor to disease pathophysiology, suggesting its value as both a biomarker and therapeutic target.

What experimental approaches can be used to modulate Claudin-2 expression in cellular models?

Several methodological approaches have proven effective for modulating Claudin-2 expression in research settings:

  • siRNA-mediated knockdown: Transfection of Claudin-2-specific siRNA oligonucleotides has been successfully employed to significantly reduce both mRNA and protein expression in endothelial cells. This approach typically achieves substantial reduction in expression within 24-48 hours post-transfection .

  • Lentiviral-based shRNA delivery: For stable knockdown models, lentiviral vectors expressing short hairpin RNAs targeting Claudin-2 provide longer-term suppression of expression and are suitable for extended experimental timelines .

  • Adenoviral overexpression systems: Adenoviral vectors carrying the Claudin-2 gene (Adv-Claudin-2) have been effectively used to achieve robust overexpression in various cell types, creating gain-of-function models. This approach significantly increases both mRNA and protein levels of Claudin-2 .

  • CRISPR/Cas9 genome editing: While not explicitly mentioned in the provided search results, this technology represents a cutting-edge approach for generating complete Claudin-2 knockout cell lines or animal models.

When implementing these techniques, appropriate controls are essential: non-targeting siRNA/shRNA controls for knockdown experiments and empty vector controls for overexpression studies ensure that observed effects are specifically attributable to Claudin-2 modulation rather than experimental manipulation.

How does Claudin-2 interact with the complement system, and what methodologies best assess this relationship?

Claudin-2 has been demonstrated to enhance complement activation and subsequent formation of the membrane attack complex (MAC) in porcine endothelial cells exposed to human serum. The relationship between Claudin-2 and complement can be methodologically assessed through:

  • Flow cytometry analysis of complement deposition: This approach allows quantification of C3c, C9, and C5b-9 (MAC) deposition on cell surfaces. Research has shown that Claudin-2 knockdown significantly reduces the deposition of these complement components, while Claudin-2 overexpression enhances their deposition .

  • Complement-dependent cytotoxicity (CDC) assays: Cell viability methods such as CCK8 and neutral red assays can be employed to measure the functional impact of Claudin-2 modulation on complement-mediated cell death. These assays reveal that Claudin-2 expression levels directly correlate with the extent of cytotoxicity in human antibody-mediated CDC models .

  • Pharmacological inhibition studies: Using complement pathway inhibitors (e.g., LNP023 targeting factor B) in conjunction with Claudin-2 modulation reveals pathway specificity. Research has demonstrated that alternative complement pathway inhibition does not affect cytotoxicity in Claudin-2-mediated human antibody CDC models, suggesting classical pathway involvement .

Importantly, Claudin-2 does not appear to exert its effects by altering the expression of complement regulators (CD46, CD55, CD59, Factor H, and Factor I), suggesting direct involvement in either antibody binding or complement activation processes .

What are the technical considerations when producing and purifying recombinant human Claudin-2 for functional studies?

When producing recombinant human Claudin-2 for research applications, several technical considerations are critical:

  • Expression system selection: As a transmembrane protein, Claudin-2 requires an expression system that supports proper folding and post-translational modifications. Mammalian expression systems (HEK293 or CHO cells) typically yield protein with native conformation and glycosylation patterns.

  • Fusion tags optimization: Strategic placement of affinity tags (e.g., His, FLAG, or GST) is crucial. C-terminal tags are generally preferred to avoid interference with N-terminal signal sequences that may be important for proper membrane insertion and folding.

  • Solubilization strategy: As an integral membrane protein, Claudin-2 requires careful selection of detergents for extraction and purification. Detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are often suitable for maintaining protein stability while effectively solubilizing from membranes.

  • Functional validation: Post-purification validation should include both structural integrity assessment (circular dichroism, thermal stability assays) and functional testing (ability to form paracellular channels in reconstituted systems).

  • Storage conditions optimization: Purified Claudin-2 typically requires stabilization with appropriate detergent concentrations above the critical micelle concentration and should be stored at -80°C with cryoprotectants to maintain functionality.

These technical considerations ensure that recombinant Claudin-2 preparations retain native structure and functional properties for downstream experimental applications.

How does Claudin-2 contribute to xenograft rejection mechanisms, and what experimental models best demonstrate this?

Claudin-2 plays a significant role in xenotransplantation rejection through enhancing human antibody-mediated complement-dependent cytotoxicity (CDC). This contribution can be studied through several experimental approaches:

  • In vitro CDC models: Systems employing porcine endothelial cells (PAECs or PIECs) exposed to human serum provide a controlled environment to study Claudin-2's role. These models reveal that Claudin-2 knockdown protects against cytotoxicity while overexpression enhances it, demonstrating a direct relationship between Claudin-2 levels and xenograft rejection mechanisms .

  • Antibody binding assays: Flow cytometry-based methods to quantify human IgG and IgM binding to porcine cells show that Claudin-2 significantly influences antibody binding. Cells with reduced Claudin-2 expression exhibit decreased antibody binding, while Claudin-2 overexpression increases binding, suggesting Claudin-2 either functions as a xenoantigen or modulates the presentation of other xenoantigens .

  • Complement activation assessment: Measuring deposition of complement components (C3c, C9, and C5b-9) on cell surfaces demonstrates that Claudin-2 facilitates complement activation and membrane attack complex formation, key steps in xenograft rejection .

The development of Claudin-2-deficient pigs represents a promising strategy to reduce inflammatory responses in xenotransplantation, as Claudin-2 deficiency in mice has demonstrated normal appearance and behavior with only altered Na+ and water reabsorption in the kidney .

What is the relationship between Claudin-2 expression and disease progression in inflammatory bowel diseases?

Claudin-2 expression shows a significant correlation with disease progression in inflammatory bowel diseases, particularly ulcerative colitis. The relationship can be characterized as follows:

  • Expression pattern correlation: Increased Claudin-2 expression correlates with the microscopical Geboes score (a measure of disease severity) in samples that retain crypt morphology. This correlation indicates that Claudin-2 expression increases proportionally with inflammation severity until the point of tissue destruction .

  • Barrier dysfunction mechanism: Upregulation of Claudin-2 by inflammatory cytokines is hypothesized to contribute directly to epithelial barrier dysregulation, a hallmark of IBD pathophysiology. Claudin-2 forms cation-selective channels that increase paracellular permeability, potentially exacerbating inflammation through increased luminal antigen exposure .

  • Biomarker potential: The correlation between Claudin-2 expression and disease severity supports its potential utility as a biomarker for monitoring disease progression and therapeutic response. Validated in situ hybridization assays for Claudin-2 mRNA detection provide a reliable method for assessing this biomarker in clinical samples .

Interestingly, in samples with the highest Geboes scores (indicating severe disease), the correlation with Claudin-2 expression is less distinct, likely due to extensive crypt destruction that alters the tissue architecture where Claudin-2 would normally be expressed .

What methodological approaches can be used to investigate Claudin-2's role in epithelial barrier function perturbation?

Several robust methodological approaches can be employed to investigate Claudin-2's involvement in epithelial barrier function:

  • Transepithelial electrical resistance (TEER) measurements: This quantitative technique measures the electrical resistance across a cell monolayer as an indicator of barrier integrity. In Claudin-2 modulation studies, TEER measurements can detect changes in paracellular ion permeability, with decreased resistance typically observed with Claudin-2 overexpression and increased resistance with Claudin-2 knockdown.

  • Paracellular permeability assays: Using differently sized molecular tracers (e.g., FITC-dextran of varying molecular weights) allows researchers to assess size-selective barrier properties. Claudin-2 specifically affects the permeation of small cations and low molecular weight molecules, so size discrimination in permeability changes is informative about Claudin-2's specific contribution.

  • Permeability studies with inflammatory stimuli: Inflammatory cytokines like TNF-α significantly increase cellular permeability in endothelial and epithelial models. Comparative studies show that while TNF-α induces substantial permeability increases, Claudin-2 knockdown causes more modest increases (approximately 1.5-fold), suggesting different mechanisms of barrier disruption .

  • Claudin-2 genetic modulation in polarized epithelial models: Using siRNA, shRNA, or CRISPR/Cas9 approaches in polarized epithelial cell models (e.g., Caco-2, T84 cells) allows for direct assessment of Claudin-2's contribution to barrier properties. These systems permit controlled manipulation of Claudin-2 expression while maintaining the architectural complexity required for proper barrier formation.

  • Ex vivo tissue explant cultures: This approach maintains the three-dimensional architecture and cellular heterogeneity of the epithelial barrier while allowing for pharmacological or genetic manipulation of Claudin-2 expression.

These methodologies collectively provide complementary insights into Claudin-2's specific contributions to epithelial barrier function and dysfunction in pathological states.

What are common technical challenges when studying Claudin-2 in tissue samples, and how can they be overcome?

Researchers studying Claudin-2 in tissue samples frequently encounter several technical challenges:

  • Antibody specificity issues: Published antibodies may not correctly identify Claudin-2 in formalin-fixed tissues, leading to false results. Solution: Implement a rigorous validation strategy for identifying target-specific antibodies in your specific fixation conditions, including positive and negative controls, and consider using multiple antibodies targeting different epitopes .

  • Tissue fixation variability: Formalin fixation can affect epitope accessibility and detection sensitivity. Solution: Standardize fixation protocols (duration, temperature, and buffer composition) and optimize antigen retrieval methods specifically for Claudin-2 detection.

  • Expression heterogeneity: Claudin-2 expression can vary significantly between different regions of the same tissue. Solution: Implement systematic sampling approaches covering multiple tissue regions and consider digital pathology techniques for quantitative assessment of expression patterns across entire tissue sections.

  • Crypt destruction in severe inflammation: In severe inflammatory conditions with crypt destruction, correlation of Claudin-2 expression with disease severity becomes challenging. Solution: Develop and apply classification systems that account for architectural distortion when analyzing expression patterns, and consider normalizing to remaining intact crypts .

  • RNA degradation in clinical samples: RNA integrity is crucial for accurate in situ hybridization results. Solution: Minimize time between sample collection and fixation, use RNase-free reagents throughout processing, and consider RNA integrity assessment methods like RIN (RNA Integrity Number) evaluation prior to analysis.

How can researchers address data inconsistencies when comparing results from different Claudin-2 detection methods?

When faced with discrepancies between different Claudin-2 detection methods, researchers should implement a systematic approach:

This systematic approach allows researchers to resolve data inconsistencies and determine which results most accurately reflect true Claudin-2 biology in their experimental system.

What experimental controls are essential when studying Claudin-2 function in immune response modulation?

When investigating Claudin-2's role in immune response modulation, particularly in complement activation and antibody-mediated cytotoxicity, several essential controls must be implemented:

  • Genetic modification controls:

    • For knockdown experiments: Non-targeting siRNA/shRNA controls that undergo identical transfection procedures but do not target Claudin-2 or other genes (ShNC controls)

    • For overexpression studies: Empty vector controls expressing the same vector backbone without the Claudin-2 insert (Adv-control)

    • Multiple targeting constructs: Use of at least two different siRNA/shRNA sequences targeting different regions of Claudin-2 mRNA to confirm specificity of effects (ShCLDN2-1 and ShCLDN2-2)

  • Serum controls:

    • Heat-inactivated human serum (HIHS) serves as a critical control to distinguish complement-dependent effects from complement-independent antibody effects

    • Serum dilution series to establish dose-response relationships

    • Species-matched serum controls when studying xenotransplantation phenomena

  • Pathway specificity controls:

    • Pathway inhibitors like LNP023 (alternative complement pathway inhibitor) help determine which complement activation pathways are involved

    • Combined knockdown/inhibitor treatments to identify potential compensatory mechanisms

  • Functional validation controls:

    • Positive cytotoxicity controls: Known inducers of cell death (e.g., TNF-α plus cycloheximide)

    • Multiple cell viability assays (e.g., both CCK8 and neutral red assays) to confirm cytotoxicity results through independent methods

    • Barrier function assessment (permeability assays) to correlate with immune response outcomes

  • Expression verification:

    • Both mRNA (qPCR) and protein (Western blot) verification of Claudin-2 modulation, rather than relying on a single measure of expression changes

These controls ensure that observed effects can be specifically attributed to Claudin-2 modulation rather than experimental artifacts or non-specific effects of the experimental manipulation.

What are promising therapeutic strategies targeting Claudin-2 in inflammatory diseases?

Several promising therapeutic strategies targeting Claudin-2 deserve investigation:

These strategies represent promising directions for translational research, particularly in inflammatory bowel diseases and xenotransplantation applications where Claudin-2's role has been most clearly established.

What methodological advances are needed to better understand Claudin-2's molecular interactions and signaling pathways?

To advance our understanding of Claudin-2's molecular interactions and signaling networks, several methodological developments are required:

  • Advanced protein interaction studies: Implementation of co-immunoprecipitation (Co-IP) combined with mass spectrometry (MS) approaches to identify proteins that directly interact with Claudin-2. These methods could reveal previously unknown binding partners that mediate Claudin-2's effects on antibody binding and complement activation .

  • Structural biology approaches: Development of methods to determine the three-dimensional structure of Claudin-2 in its native membrane environment, potentially using cryo-electron microscopy or X-ray crystallography of stabilized protein complexes, would provide insights into channel formation mechanisms.

  • Live cell imaging techniques: Real-time visualization of Claudin-2 dynamics within tight junction complexes using advances in super-resolution microscopy combined with fluorescent protein tagging could reveal dynamic changes in response to inflammatory stimuli.

  • Single-cell analysis methods: Techniques to assess Claudin-2 expression and function at the single-cell level would help understand heterogeneity within tissues and identify specific cell populations most affected by Claudin-2 modulation.

  • Computational modeling approaches: Development of in silico models of Claudin-2 channel function and integration into larger models of epithelial barrier dynamics would help predict the functional consequences of Claudin-2 modulation in complex biological systems.

  • Organoid-based screening platforms: Advanced three-dimensional culture systems that better recapitulate in vivo tissue architecture could serve as platforms for screening Claudin-2 modulators and studying their effects on barrier function in physiologically relevant models.

These methodological advances would address current knowledge gaps, particularly regarding the mechanisms by which Claudin-2 modulates antibody binding and complement activation, which remain incompletely understood despite their functional importance .

How might differential expression of Claudin-2 across tissue types impact targeted therapeutic development?

The differential expression pattern of Claudin-2 across tissues creates both challenges and opportunities for therapeutic development:

  • Tissue-specific effects consideration: Claudin-2 exhibits variable expression across organs, with high levels in proximal tubules of the kidney and certain regions of the intestine under normal conditions. Therapeutic strategies must account for these natural expression patterns to anticipate potential off-target effects. For example, inhibitors of Claudin-2 designed for inflammatory bowel disease might affect renal sodium handling, as Claudin-2 deficient mice show altered Na+ and water reabsorption in the kidney .

  • Selective drug delivery systems design: The tissue-specific expression profile of Claudin-2 can be leveraged for targeted drug delivery. Nanoparticles or other delivery systems could be designed to preferentially release therapeutic agents in tissues with elevated Claudin-2 expression, such as inflamed intestinal segments in ulcerative colitis.

  • Precision medicine approaches: Individual variation in baseline Claudin-2 expression and disease-associated changes could inform patient stratification for clinical trials and eventual therapeutic selection. Development of companion diagnostics assessing Claudin-2 expression could identify patients most likely to benefit from Claudin-2-targeted therapies.

  • Biomarker development methodology: The validated in situ hybridization assay for Claudin-2 detection could serve as a foundation for developing tissue-specific biomarker assays to monitor therapeutic response. This requires considering the unique characteristics of each tissue type in assay optimization and validation .

  • Therapeutic window determination: The relationship between Claudin-2 expression and disease severity may not be linear across all tissues or disease states. For instance, in ulcerative colitis, Claudin-2 expression correlates with disease severity in samples with intact crypt morphology but not in those with severe crypt destruction . Understanding these tissue-specific and disease stage-specific relationships is crucial for establishing appropriate therapeutic windows.

These considerations highlight the importance of comprehensive tissue profiling and context-specific validation when developing therapeutics targeting Claudin-2.

What are the most critical unresolved questions regarding Claudin-2 function that researchers should prioritize?

Despite significant advances in understanding Claudin-2 biology, several critical questions remain unresolved:

  • Mechanism of antibody binding modulation: While it's established that Claudin-2 enhances antibody binding to cell surfaces, the precise mechanism remains unclear. Is Claudin-2 itself a direct target of antibodies, does it alter the expression or presentation of other antigens, or does it modulate the antibody binding process through other means? Addressing this fundamental question is essential for applications in xenotransplantation and autoimmune disease research .

  • Pathway specificity in complement activation: Although Claudin-2 clearly enhances complement activation, the specific pathways and molecular interactions involved require further elucidation. Does Claudin-2 directly interact with complement components, or does its effect on complement activation occur solely through enhanced antibody binding ?

  • Interplay with other tight junction proteins: How does Claudin-2 functionally interact with other tight junction proteins that show distinct roles in immune rejection processes, such as Occludin, ZO-1, and Claudin-5? Understanding these interactions could reveal synergistic targets for therapeutic intervention .

  • Transcriptional and post-transcriptional regulation: What are the precise mechanisms regulating Claudin-2 expression in different pathological states? While cytokines are known to upregulate Claudin-2, the specific transcription factors and signaling pathways involved remain incompletely characterized.

  • Structure-function relationships: How do specific domains of Claudin-2 contribute to its various functions in barrier regulation, immune response modulation, and channel formation? Structural insights could guide rational design of inhibitors targeting specific functions while preserving others.

Addressing these questions would significantly advance both basic understanding of Claudin-2 biology and facilitate translational applications in disease treatment.

What standardized protocols would advance reproducibility in Claudin-2 research?

To enhance reproducibility in Claudin-2 research, the following standardized protocols are recommended:

  • Antibody validation framework: Implementation of a tiered antibody validation approach for Claudin-2 detection that includes:

    • Western blot validation with appropriate positive and negative controls

    • Knockout/knockdown validation to confirm specificity

    • Cross-validation with orthogonal detection methods

    • Documentation of optimal dilutions and incubation conditions

  • In situ hybridization protocol standardization: Adoption of validated in situ hybridization protocols for Claudin-2 mRNA detection in formalin-fixed tissues, including standardized probe design, hybridization conditions, and signal development parameters .

  • Cell culture harmonization: Establishment of consistent protocols for:

    • Cell line authentication and passage number limitations

    • Defined media compositions and serum batch testing

    • Standard confluence levels for experimentation

    • Consistent transfection methodologies for genetic manipulation

  • Complement activation assay standardization: Development of reference protocols for:

    • Human serum preparation and storage

    • Flow cytometry-based detection of complement components (C3c, C9, C5b-9)

    • Cytotoxicity assay conditions (cell density, serum concentration, incubation times)

  • Barrier function measurement standardization: Consensus methods for:

    • Transepithelial/transendothelial electrical resistance (TEER) measurements

    • Paracellular permeability assay conditions with defined molecular tracers

    • Data normalization approaches to account for variations in cell density and growth surface area

  • Reporting standards implementation: Adoption of minimum information reporting standards for:

    • Detailed experimental protocols including buffer compositions

    • Complete reagent information including catalog numbers and lot numbers

    • Raw data sharing through appropriate repositories

    • Comprehensive statistical analysis documentation

Implementation of these standardized protocols would significantly enhance reproducibility and facilitate comparison of results across different laboratories, accelerating progress in Claudin-2 research.

What multidisciplinary approaches could accelerate advances in Claudin-2-targeted therapeutics?

Advancing Claudin-2-targeted therapeutics requires integration of multiple scientific disciplines:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.