Recombinant Human Claudin-6 (CLDN6), partial

Shipped with Ice Packs
In Stock

Description

Biological Functions and Pathological Relevance

Claudin-6 plays a pivotal role in maintaining tight junction integrity, regulating paracellular permeability, and acting as a co-receptor for hepatitis C virus (HCV) entry into hepatic cells . Its dysregulation is implicated in multiple pathologies:

  • Cancer: Overexpressed in ovarian, testicular, and endometrial cancers but absent in most normal adult tissues .

  • Developmental Role: Silenced post-embryogenesis; aberrant re-expression in tumors correlates with metastasis and poor prognosis .

  • HCV Infection: Facilitates viral entry alongside other receptors like CD81 .

Preclinical Studies

  • Antibody-Drug Conjugates (ADCs):

    • CLDN6-MMAE (monomethyl auristatin E) induced apoptosis in germ cell tumors (GCTs) with reduced off-target toxicity compared to free MMAE .

    • CLDN6-23-ADC demonstrated tumor regression in ovarian cancer PDX models .

  • CAR-T Cell Therapy:

    • CLDN6-targeted CAR-T cells achieved a 33% objective response rate (ORR) in refractory metastatic solid tumors .

Key Challenges

  • Limited clinical efficacy observed in Phase II trials (e.g., ASP1650 showed 0% ORR in germ cell tumors) .

  • Toxicity concerns, including cytokine release syndrome (46% of patients in CAR-T trials) .

Clinical Trial Overview

Trial IdentifierPhaseTargetOutcome
NCT03760081IIGerm cell tumors0% ORR; trial terminated
Recruiting trialsI/IbSolid tumorsEvaluating CLDN6-ADC and CAR-T combinations

Future Directions

Research is focused on optimizing CLDN6-targeted therapies, including bispecific antibodies and combination regimens with checkpoint inhibitors . The restricted expression profile of CLDN6 in tumors versus normal tissues continues to drive its appeal as a therapeutic target.

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5% to 50% glycerol.
Please note: If you require a specific glycerol concentration, kindly specify this in your order remarks.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based solution containing 6% Trehalose.

Description

This recombinant Human CLDN6 protein is a partial protein produced via in vitro expression in E. coli (cell-free). It boasts a purity exceeding 90%, as determined by SDS-PAGE. Cell-free protein expression is a technique that involves in vitro protein synthesis using translation-compatible extracts derived from whole cells. Essentially, these extracts contain all the necessary macromolecules and components for transcription, translation, and even post-translational modifications. These components include RNA polymerase, regulatory protein factors, transcription factors, ribosomes, and tRNA. When supplemented with cofactors, nucleotides, and the specific gene template, these extracts can synthesize proteins of interest within a few hours.

CLDN6 is a tight junction molecule that plays a crucial role in cell-to-cell adhesion within epithelial or endothelial cell sheets, contributing to the maintenance of cell integrity. CLDN6 is indispensable for the formation of barriers, particularly the lung epithelial barrier and the epidermal permeability barrier (EPB), which effectively prevent the free passage of solutes and water through the extracellular space. CLDN6 exhibits aberrant expression in various malignancies, including ovarian cancer and testicular cancer. It has been implicated in cancer initiation, proliferation, apoptosis, migration, invasion, and progression. Furthermore, its abnormal expression is associated with Hepatitis C infection.
Form
Available in Liquid or Lyophilized powder format
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in your order remarks, and we will prepare the product accordingly.
Lead Time
Standard lead time is 3-7 business days.
Notes
To preserve protein integrity, repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. To enhance long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
In general, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
This protein is N-terminally tagged with 6xHis-SUMO.
Synonyms
CLDN6; UNQ757/PRO1488; Claudin-6; Skullin
Datasheet & Coa
Please contact us to get it.
Expression Region
1-82aa
Mol. Weight
24.8kDa
Protein Length
Partial
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
CLDN6 plays a pivotal role in tight junction-specific obliteration of the intercellular space. In the context of microbial infections, CLDN6 acts as a receptor facilitating hepatitis C virus (HCV) entry into hepatic cells.
Gene References Into Functions
  1. Antibodies targeting native CLDN6 displayed on cell surfaces and mediating complement-dependent cytotoxicity were elicited in vaccinated animals. This data suggests potential applications for CLDN6 displaying Virus-like particles in cancer immunotherapy. PMID: 29131519
  2. These findings indicate that Helicobacter pylori lipopolysaccharide induces TLR2 expression in gastric adenocarcinoma cells. Prolonged exposure to lipopolysaccharide leads to increased TLR2 expression in the cell membrane, resulting in elevated expression of claudin-4, -6, -7, and -9. PMID: 29031421
  3. This study provides evidence that high CLDN6 expression confers chemoresistance in breast cancer, mediated by GSTP1, whose activity is regulated by p53. PMID: 29116019
  4. CLDN6 enhances chemoresistance to ADM by activating the AF-6/ERK signaling pathway and upregulating cancer stem cell characteristics in MDAMB231 cells. PMID: 29159771
  5. Our research demonstrates that CLDN6 downregulation is regulated through promoter methylation by DNMT1, dependent on the SMAD2 pathway. CLDN6 acts as a key regulator in the SMAD2/DNMT1/CLDN6 pathway, inhibiting EMT, migration, and invasion of breast cancer cells. PMID: 28867761
  6. In conclusion, these bioinformatics insights will contribute to future endeavors aimed at better understanding CLDN6 regulation and functions. PMID: 28656265
  7. High CLDN 6 expression was observed in approximately 65% of myxofibrosarcomas, while benign soft tissue tumors did not exhibit high CLDN 6 expression. The expression of CLDN 6 in myxofibrosarcomas was significantly higher than other tumor specimens. Notably, high CLDN 6 expression within myxofibrosarcomas correlated with high FNCLCC grades and high AJCC stages. PMID: 28476380
  8. Results demonstrate that DNA methylation downregulates CLDN6 expression through MeCP2 binding to the CLDN6 promoter, deacetylating H3 and H4, and altering chromatin structure, ultimately promoting migratory and invasive phenotypes in breast cancer cells. PMID: 27461117
  9. Cldn6 expression was diminished in alveolar type II-like epithelial cells (A549) and primary small airway epithelial cells when exposed to cigarette smoke extract. PMID: 27982694
  10. This study suggests that claudin-6 induces MMP-2 activation through claudin-1 membrane expression. PMID: 27914788
  11. Data indicate that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not impact HCV pseudoparticles (HCVpp) entry. PMID: 26561856
  12. The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues. PMID: 26191261
  13. High levels of CLDN6 are associated with non-small-cell lung cancer. PMID: 24710653
  14. The expression of claudin-6 was downregulated in gastric cancer tissue. PMID: 23919729
  15. Only certain hepatitis C virus strains effectively utilize CLDN6 for infection. PMID: 23775920
  16. This work provides a proof of concept for employing Claudin-6 to eliminate residual undifferentiated human pluripotent stem cells from culture. PMID: 23778593
  17. While claudin-6 and claudin-9 can serve as entry factors in cell lines, hepatitis C virus infection into human hepatocytes is not contingent upon claudin-6 and claudin-9. PMID: 23864633
  18. ASK1 signaling may play a positive role in the inhibitory effect of claudin-6 in breast cancer. PMID: 22925655
  19. Our results show that claudin-6 protein is significantly downregulated in breast invasive ductal carcinomas. PMID: 22455563
  20. CLDN6 is not a specific biomarker for atypical teratoid rhabdoid tumors as it is expressed in a variety of other pediatric CNS and soft tissue tumors. PMID: 21989342
  21. 17beta-E2 might regulate the expression of claudin-6 and inhibit the proliferation and migration of MCF-7 cells. PMID: 20388399
  22. Increased expression of claudin-6, claudin-7, or claudin-9 is sufficient to enhance the tumorigenic properties of a gastric adenocarcinoma cell line. PMID: 20874001
  23. CLDN6 may serve as a useful positive marker to aid in the further identification of atypical teratoid/rhabdoid tumors for diagnostic and treatment purposes. PMID: 19220299
  24. Claudins 6, 7, and 9 expressions are closely associated with gastric carcinogenesis. PMID: 19960275
  25. The upregulation of claudin-6 expression in MCF-7 breast cancer cells suppresses their malignant phenotypes, correlated with the restoration of tight junction integrity. PMID: 20367941
  26. Claudin-6 downregulates the malignant phenotype of breast carcinoma. PMID: 20215972
  27. Claudin 6 was not detected in epithelioid glioblastomas or rhabdoid glioblastomas. PMID: 20118769
  28. CLDN6 and CLDN9, but not CLDN1, are expressed in peripheral blood mononuclear cells, an additional site of HCV replication. PMID: 17804490
  29. Claudin-6 and claudin-9 expressed in CD81+ cells also enable the entry of HCV pseudoparticles derived from six of the major genotypes. PMID: 18234789
  30. CLDN6, clustered with CLDN9 at human chromosome 16p13.3, is a four-transmembrane protein with a WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. PMID: 12736707

Show More

Hide All

Database Links

HGNC: 2048

OMIM: 615798

KEGG: hsa:9074

STRING: 9606.ENSP00000328674

UniGene: Hs.533779

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.

Q&A

What is Claudin-6 and what is its biological function?

Claudin-6 (CLDN6) is a tight junction transmembrane protein that plays a crucial role in cell-to-cell adhesion of epithelial or endothelial cell sheets and maintains cellular integrity. It belongs to the claudin family of proteins that are essential components of tight junctions, which seal the paracellular space between adjacent cells. CLDN6 specifically contributes to the tight junction-specific obliteration of the intercellular space, functioning as a barrier that regulates the passage of ions and molecules through the paracellular pathway. This protein is particularly important for the formation of critical barriers in the body, including the lung epithelial barrier and the epidermal permeability barrier (EPB), which prevent solutes and water from freely traversing through the extracellular space. The barrier function is essential for maintaining distinct compartments within tissues and organs, ensuring proper physiological functions and preventing the uncontrolled mixing of biological fluids.

What is the structure of human CLDN6 protein?

Human CLDN6 is a four-pass transmembrane protein consisting of 220 amino acids. From a structural perspective, CLDN6 contains four transmembrane regions and two extracellular loops, with an intracellular loop connecting the amino and carboxyl termini located in the cytoplasm. The crystal structures of claudin family proteins reveal a unique protein fold consisting of a left-handed helical bundle formed by the four transmembrane helices, along with an extracellular caudal domain. This characteristic structural arrangement is critical for CLDN6's ability to interact with adjacent cells and form tight junction complexes. The extracellular loops are particularly important for homophilic and heterophilic interactions with claudins on adjacent cells, contributing to the selective paracellular permeability properties of tight junctions.

Why is CLDN6 of interest in cancer research?

CLDN6 has emerged as a compelling target in cancer research due to its unique expression pattern and potential therapeutic applications. Unlike many proteins, CLDN6 is almost undetectable in normal adult tissues but is abnormally expressed in numerous malignancies, making it an ideal cancer-specific target with minimal risk of off-target effects. CLDN6 shows frequent expression in ovarian cancer, testicular cancer, endometrial cancer, hepatocellular carcinoma, and lung adenocarcinoma. Research has implicated CLDN6 in multiple aspects of cancer biology, including cancer initiation, proliferation, apoptosis, migration, invasion, and progression. This selective expression pattern has led to significant interest in developing CLDN6-targeted therapies, including T-cell receptor (TCR) gene-engineered T-cell therapy and other immunotherapeutic approaches. The fact that CLDN6 is a cell surface membrane protein makes it particularly accessible for targeted therapies, further enhancing its appeal as a cancer research target.

What are the different expression systems for producing recombinant CLDN6, and how do they impact protein quality?

Recombinant CLDN6 can be produced using several expression systems, each with distinct advantages and limitations that affect protein quality and experimental utility. Mammalian cell expression systems (particularly HEK293 cells) produce full-length CLDN6 (1-220 amino acids) with proper post-translational modifications and protein folding, resulting in proteins with >95% purity and low endotoxin levels (<1 EU/μg). This system is optimal for functional studies requiring native-like protein conformation, particularly for membrane proteins like CLDN6 that require specific folding of transmembrane domains. E. coli-based cell-free expression systems produce partial CLDN6 proteins with approximately 90% purity as determined by SDS-PAGE. While this system offers rapid production, the resulting proteins may lack critical post-translational modifications necessary for full biological activity. The Virus-Like Particles (VLPs) platform represents another approach for expressing CLDN6, maintaining the protein's transmembrane structure while facilitating display of conformational epitopes. When selecting an expression system, researchers should consider their experimental requirements: functional assays generally require mammalian-expressed proteins, while structural studies or antibody generation might work with E. coli-expressed fragments.

How can researchers validate the activity and functionality of recombinant CLDN6 proteins?

Validating recombinant CLDN6 functionality requires multiple complementary approaches to confirm both structural integrity and biological activity. Functional ELISA represents a primary validation method, assessing the protein's binding ability to known interaction partners or specific antibodies, with EC50 values typically in the range of 1.726-3.525 nM indicating proper folding and epitope presentation. Cell-based assays measuring tight junction formation can directly assess CLDN6's primary biological function—researchers can transfect CLDN6-negative epithelial cells with the recombinant protein and measure transepithelial electrical resistance (TEER) or paracellular permeability using fluorescent tracers. Structural validation through circular dichroism (CD) spectroscopy or limited proteolysis can confirm proper protein folding, particularly important for transmembrane proteins with complex topologies like CLDN6. For immunological applications, researchers should validate CLDN6 by demonstrating specific binding to anti-CLDN6 antibodies through Western blotting, immunoprecipitation, or flow cytometry, with particular attention to recognition of conformational epitopes in the extracellular domains. When testing CLDN6 in HCV entry models, functionality can be confirmed by showing the protein's ability to facilitate viral entry into hepatic cells in vitro.

What techniques are most effective for studying CLDN6 expression in tissue samples and cell lines?

A multi-modal approach is essential for accurately characterizing CLDN6 expression patterns across different experimental systems. Flow cytometry using validated anti-CLDN6 antibodies (such as clone 342927 from R&D Systems) enables quantitative assessment of surface CLDN6 expression on cell populations, with appropriate controls including CLDN6-negative cell lines and isotype antibodies. This technique is particularly valuable for detecting differential expression following treatments like interferon-gamma (IFN-γ) stimulation. Immunohistochemistry (IHC) and immunofluorescence (IF) provide spatial information about CLDN6 localization within tissues and cell junctions, although these techniques require careful antibody validation and optimization of fixation protocols to preserve the native conformation of transmembrane proteins. At the transcriptional level, quantitative RT-PCR remains crucial for measuring CLDN6 mRNA expression, often revealing discrepancies between transcript and protein levels that can inform post-transcriptional regulation mechanisms. Western blotting with appropriate sample preparation techniques (using specialized membrane protein extraction buffers) can detect CLDN6 protein expression, though researchers should be aware that standard lysis protocols may inadequately solubilize this transmembrane protein. Single-cell RNA sequencing has emerged as a powerful approach for characterizing heterogeneous CLDN6 expression within tumor samples, revealing distinct subpopulations with variable expression levels.

What are the key considerations for designing experiments to study CLDN6 in cancer models?

Designing robust experiments to investigate CLDN6 in cancer contexts requires careful consideration of several critical factors. Model selection should prioritize systems that recapitulate the relevant CLDN6 expression patterns—researchers should screen potential cell lines using flow cytometry and qRT-PCR before experiments, as CLDN6 expression varies significantly across cancer types and can change with passage number. For in vivo studies, patient-derived xenograft (PDX) models often better preserve CLDN6 expression patterns than traditional cell line-based xenografts. Expression manipulation approaches should include both gain-of-function (using CLDN6-expressing plasmids with appropriate promoters) and loss-of-function (CRISPR-Cas9 knockout or siRNA knockdown) strategies, with particular attention to rescue experiments that can confirm phenotype specificity. When studying CLDN6's role in cancer processes (migration, invasion, proliferation), researchers should employ multiple complementary assays rather than relying on a single technique, as CLDN6 affects multiple cellular pathways. For therapeutic targeting studies, researchers must validate antibody specificity against related claudin family members (especially CLDN9, which shares high sequence homology) and consider the microenvironmental factors that might modulate CLDN6 expression, including hypoxia, inflammation, and cell-cell contacts.

How can CLDN6 be utilized in developing cancer immunotherapies?

CLDN6 presents a compelling target for cancer immunotherapy development due to its cancer-specific expression pattern and accessibility on the cell surface. T-cell receptor (TCR) gene-engineered T-cell therapy represents one promising approach—researchers can identify and isolate TCR genes specific to CLDN6 epitopes (such as TLIPVCWTA, amino acids 132-140) presented by HLA molecules like HLA-A*02:01. These TCR genes can then be engineered into patient T cells to create targeted immunotherapies. The development process involves stimulating T cells with synthetic overlapping peptides for CLDN6, isolating responsive T cells through cytokine secretion assays, and cloning their TCR genes for expression in therapeutic T cells. Beyond TCR-based approaches, researchers have developed chimeric antigen receptor (CAR) T-cell therapies targeting CLDN6, requiring careful design of single-chain variable fragments (scFvs) that recognize properly folded CLDN6 epitopes with high specificity. Bi-specific T-cell engagers (BiTEs) targeting CLDN6 represent another therapeutic modality under investigation, with critical design parameters including epitope selection and linker optimization. For all immunotherapy approaches, researchers must thoroughly validate specificity against related claudin family members and confirm lack of reactivity with normal tissues to prevent on-target/off-tumor toxicity.

What role does CLDN6 play in viral infections, particularly Hepatitis C?

CLDN6 functions as a co-receptor for Hepatitis C virus (HCV) entry into hepatic cells, representing an important aspect of CLDN6 biology beyond its structural role in tight junctions. The virus utilizes CLDN6's extracellular domains to facilitate its binding and subsequent internalization into hepatocytes, making CLDN6 a critical determinant of HCV tropism and infection efficiency. Researchers investigating this interaction typically employ cell culture systems with controlled CLDN6 expression levels, using either overexpression constructs in CLDN6-negative cells or CRISPR-based knockout in CLDN6-positive cells. Pseudotyped viral particles bearing HCV envelope glycoproteins provide a safer alternative to infectious HCV for studying entry mechanisms. The specific regions of CLDN6 involved in HCV interactions include the first extracellular loop (ECL1), which contains critical residues that directly interact with viral envelope proteins. Notably, CLDN6's role overlaps partially with CLDN1, another claudin family member involved in HCV entry, suggesting redundancy in the viral entry mechanisms. Therapeutic approaches targeting CLDN6-mediated viral entry include neutralizing antibodies against specific epitopes on CLDN6's extracellular domains and small molecule inhibitors that disrupt protein-protein interactions between CLDN6 and HCV envelope proteins.

What are the challenges in developing specific antibodies against CLDN6 and how can they be overcome?

Developing specific antibodies against CLDN6 presents several technical challenges that require specialized approaches to overcome. The high sequence homology between CLDN6 and other claudin family members (particularly CLDN9, which shares approximately 70% amino acid identity) creates significant cross-reactivity issues—researchers must carefully select epitopes unique to CLDN6, typically focusing on the more divergent regions in the second extracellular loop (ECL2) or the C-terminal domain. The complex topology of CLDN6 as a four-pass transmembrane protein complicates antibody development, as many epitopes are conformational and dependent on proper protein folding. To address this, immunization strategies should utilize full-length recombinant CLDN6 proteins expressed in mammalian systems (like HEK293 cells) that maintain native-like conformation, preferably embedded in liposomes or virus-like particles (VLPs) to preserve membrane context. Antibody screening protocols must incorporate multiple validation steps, including flow cytometry with CLDN6-positive and negative cell lines, immunoprecipitation followed by mass spectrometry, and cross-reactivity testing against related claudins. For therapeutic antibody development, researchers should evaluate antibodies not only for specificity but also for functional effects on tight junction formation and potential internalization properties that could affect drug delivery. Overcoming these challenges typically requires iterative optimization of both immunization and screening strategies.

How does post-translational modification affect CLDN6 function and experimental design?

Post-translational modifications (PTMs) significantly impact CLDN6 function and must be carefully considered in experimental design. Phosphorylation represents one of the most crucial PTMs affecting CLDN6—several serine and threonine residues in the C-terminal cytoplasmic domain can be phosphorylated by kinases including PKC and PKA, modulating protein-protein interactions, tight junction assembly, and stability. Researchers investigating phosphorylation should employ phospho-specific antibodies or mass spectrometry-based phosphoproteomics, with attention to preserving modification status during sample preparation. Palmitoylation of cysteine residues in CLDN6 affects its membrane association and partitioning into lipid rafts, which in turn influences tight junction formation and stability. Detecting palmitoylation requires specialized techniques like acyl-biotin exchange (ABE) or metabolic labeling with palmitate analogs. Glycosylation, though less prominent for CLDN6 than other membrane proteins, may still affect protein folding and antibody recognition—researchers should compare CLDN6 expressed in different systems (e.g., mammalian vs. bacterial) to assess glycosylation effects. When designing recombinant CLDN6 for functional studies, the expression system selection becomes critical: mammalian systems like HEK293 cells preserve most native PTMs, while E. coli-based systems lack eukaryotic PTM machinery. For structure-function studies, site-directed mutagenesis of putative modification sites can elucidate the specific contributions of individual PTMs to CLDN6 function.

What are common challenges in working with recombinant CLDN6 and how can they be addressed?

Working with recombinant CLDN6 presents several specific challenges related to its transmembrane nature and complex folding requirements. Protein solubility issues frequently arise due to CLDN6's hydrophobic transmembrane domains—researchers can address this by using specialized detergents (such as n-dodecyl-β-D-maltoside or digitonin) that effectively solubilize membrane proteins while preserving their native conformation. Optimization through detergent screening using dynamic light scattering or thermal shift assays can identify ideal solubilization conditions. Protein aggregation during purification or storage presents another common challenge, often resulting from improper folding or exposure of hydrophobic regions. Adding stabilizing agents like glycerol (10-15%) or specific lipids that mimic the membrane environment can significantly reduce aggregation. For long-term storage, researchers should avoid repeated freeze-thaw cycles by preparing single-use aliquots. Proper folding verification is essential, particularly for functional studies—circular dichroism spectroscopy can confirm secondary structure content, while binding assays with conformation-specific antibodies can verify the presence of native epitopes. When working with partial CLDN6 constructs, researchers should carefully consider which domains are included based on the experimental question, as truncated proteins may not recapitulate all aspects of full-length CLDN6 function.

How should researchers optimize experimental conditions when studying CLDN6 in different cell types?

Optimizing experimental conditions for CLDN6 studies across different cell types requires systematic adjustment of multiple parameters to account for cell-specific variations in protein expression, trafficking, and function. Transfection or transduction protocols must be cell-type optimized—epithelial cells like MDCK or Caco-2 typically require different transfection reagents and DNA:reagent ratios than hepatic cells like Huh7, with efficiency verification through reporter genes or Western blotting. Expression timing represents another critical variable, as CLDN6 localization to tight junctions requires 48-72 hours in most epithelial models but may vary in cancer cell lines. When studying endogenous CLDN6, researchers should be aware that expression levels can be modulated by cytokines like IFN-γ or TGF-β, requiring standardized culture conditions and controlled passage numbers. For functional barrier studies, researchers must optimize cell seeding density and culture duration to achieve appropriate confluence and tight junction maturation, typically monitoring transepithelial electrical resistance (TEER) to determine optimal experimental timing. Immunostaining protocols require cell-type specific optimization of fixation methods (4% paraformaldehyde for most applications, but methanol fixation may better preserve some epitopes) and permeabilization conditions (0.1-0.3% Triton X-100 for most cells, but gentler detergents like saponin for certain cell types), with careful antibody titration to achieve optimal signal-to-noise ratios.

What quality control measures should be implemented when working with recombinant CLDN6 proteins?

Implementing comprehensive quality control measures is essential when working with recombinant CLDN6 to ensure experimental reliability and reproducibility. Purity assessment represents the foundational quality control measure—SDS-PAGE analysis should confirm >90% purity for E. coli-expressed proteins and >95% for mammalian-expressed proteins, with mass spectrometry verification of protein identity and detection of potential contaminants or degradation products. Endotoxin testing is particularly important for proteins intended for cell-based assays or in vivo applications, with acceptable levels typically below 1 EU/μg protein, measured using the Limulus Amebocyte Lysate (LAL) assay. Researchers should verify proper folding through multiple complementary approaches, including circular dichroism spectroscopy to confirm secondary structure content and limited proteolysis to assess tertiary structure stability. Functional validation through binding assays (such as ELISA with EC50 determination) provides critical information about the protein's biological activity and proper epitope presentation. For lot-to-lot consistency, researchers should establish reference standards and compare key parameters including purity, folding, and activity across multiple protein preparations. When working with tagged CLDN6 constructs, researchers should confirm that the tag does not interfere with protein function through parallel experiments with tagged and untagged versions or through tag removal using specific proteases like TEV or thrombin.

How can researchers differentiate between the effects of CLDN6 and other claudin family members in experimental settings?

Distinguishing CLDN6-specific effects from those of other claudin family members requires careful experimental design and multiple validation approaches. Specific knockdown or knockout strategies represent the foundation of specificity confirmation—researchers should employ siRNA or CRISPR-Cas9 techniques targeting unique regions of CLDN6 mRNA, followed by rescue experiments with CLDN6 constructs containing silent mutations that render them resistant to the knockdown strategy. When using antibody-based detection methods, researchers must thoroughly validate specificity through Western blotting against recombinant claudin proteins (particularly CLDN9, which shares high sequence homology) and through immunostaining of cells with known claudin expression profiles. For functional studies, researchers can design chimeric proteins that swap domains between CLDN6 and other claudins to pinpoint which regions mediate specific functions. Expression profiling at both mRNA (qRT-PCR) and protein levels (Western blotting) should always include multiple claudin family members to account for potential compensatory mechanisms or co-regulation. In cancer studies, researchers should be particularly cautious about claudin expression changes during experimental manipulations—for example, CLDN6 overexpression may alter levels of other claudins through transcriptional feedback mechanisms, necessitating comprehensive expression profiling rather than measuring CLDN6 alone.

What are emerging therapeutic approaches targeting CLDN6 in cancer treatment?

The unique expression pattern of CLDN6 in cancer cells has sparked the development of multiple innovative therapeutic approaches targeting this protein. Chimeric Antigen Receptor (CAR) T-cell therapy represents one of the most promising strategies—researchers are developing CARs with single-chain variable fragments (scFvs) specifically recognizing CLDN6 extracellular domains, with early preclinical studies showing potent anti-tumor activity against CLDN6-positive cancers like ovarian and testicular tumors. Antibody-Drug Conjugates (ADCs) targeting CLDN6 are under development, utilizing humanized anti-CLDN6 antibodies conjugated to potent cytotoxic payloads like auristatins or maytansinoids, with optimal drug-antibody ratios and linker chemistry being critical design parameters. Bi-specific T-cell Engagers (BiTEs) represent another immunotherapeutic approach, with one binding domain targeting CLDN6 and another engaging CD3 on T cells to bring cytotoxic T cells into proximity with CLDN6-expressing tumor cells. Beyond direct targeting, researchers are exploring CLDN6 as a cancer vaccine target—peptide or DNA vaccines encoding CLDN6 epitopes could potentially elicit anti-tumor immune responses. The development of small molecule modulators affecting CLDN6 protein-protein interactions or trafficking represents an emerging research area, though these approaches face challenges due to the complex transmembrane topology of claudins.

How might structural biology approaches advance our understanding of CLDN6 function?

Advanced structural biology techniques have the potential to significantly deepen our understanding of CLDN6 function and enable structure-based drug design. Cryo-electron microscopy (cryo-EM) offers particular promise for determining the structure of CLDN6 within its native membrane environment, potentially revealing how CLDN6 assembles into tight junction strands and interacts with other junction components. This technique can overcome challenges associated with crystallizing membrane proteins, though sample preparation remains complex, requiring reconstitution in nanodiscs or lipid environments that maintain protein stability. X-ray crystallography, despite challenges with membrane proteins, could provide atomic-level resolution of specific CLDN6 domains, particularly when using antibody fragments to stabilize flexible regions. For investigating dynamic aspects of CLDN6 function, nuclear magnetic resonance (NMR) spectroscopy could reveal conformational changes during interactions with binding partners or in response to post-translational modifications. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) represents another valuable approach for mapping interaction surfaces and conformational changes in CLDN6 without requiring crystallization. Computational approaches like molecular dynamics simulations can complement experimental structural data by modeling CLDN6's behavior within lipid bilayers and predicting effects of mutations or small molecule binding. These structural insights could ultimately facilitate rational design of therapeutic antibodies or small molecules targeting specific functional epitopes on CLDN6.

What is the potential role of CLDN6 in developmental biology and stem cell research?

CLDN6 plays significant developmental roles that extend beyond its well-characterized functions in cancer and tight junctions, presenting opportunities for innovative research in developmental biology and stem cell fields. During embryonic development, CLDN6 shows dynamic expression patterns, particularly in the epithelial components of developing organs like the lungs, kidneys, and skin. Its expression in pluripotent stem cells and specific progenitor populations suggests potential roles in maintaining stemness or regulating differentiation trajectories. Researchers investigating these developmental functions typically employ genetic knockout models (both constitutive and conditional) combined with lineage tracing to track cell fate decisions in CLDN6-expressing populations. In embryonic stem cell (ESC) research, CLDN6 expression changes during differentiation protocols, potentially serving as a marker for specific developmental stages or lineage commitments. The protein's role in establishing epithelial barriers becomes particularly relevant in organoid models, where proper tight junction formation is essential for creating physiologically relevant tissue structures. Beyond its structural roles, emerging evidence suggests CLDN6 may participate in signaling pathways that influence cell proliferation and differentiation, potentially through interactions with growth factor receptors or adhesion-dependent signaling complexes. For researchers in regenerative medicine, understanding CLDN6's contributions to tissue barrier establishment could inform strategies for enhancing the functional maturation of stem cell-derived tissues intended for transplantation.

How might multi-omics approaches enhance our understanding of CLDN6 biology in normal and disease states?

Integrative multi-omics approaches offer powerful strategies for comprehensively understanding CLDN6 biology across physiological and pathological contexts. Single-cell RNA sequencing combined with spatial transcriptomics can reveal the heterogeneous expression patterns of CLDN6 within tissues, identifying specific cell populations that express CLDN6 and mapping their spatial relationships to other cell types—particularly valuable for understanding CLDN6's distribution in complex tumor microenvironments. Proteomics approaches, including proximity labeling techniques like BioID or APEX, can identify the CLDN6 interactome, revealing previously unknown protein-protein interactions that may influence tight junction assembly, signaling, or trafficking. Phosphoproteomics analyses can map the dynamic post-translational modification landscape of CLDN6, providing insights into how signaling pathways modulate CLDN6 function in response to environmental cues. Epigenomic profiling through techniques like ATAC-seq or ChIP-seq can elucidate the regulatory mechanisms controlling CLDN6 expression across different tissues and disease states, potentially identifying targetable transcription factors or enhancer elements. Metabolomics approaches may reveal how CLDN6-mediated barrier function influences cellular metabolism or how metabolic changes affect CLDN6 expression and function. For clinical translation, integrating these multi-omics data with patient outcomes can identify biomarker signatures that predict response to CLDN6-targeted therapies or disease progression, enabling precision medicine approaches for CLDN6-positive cancers.

What are the key considerations for designing CLDN6 overexpression and knockdown studies?

Designing robust CLDN6 overexpression and knockdown studies requires careful attention to multiple experimental parameters to ensure meaningful and interpretable results. Vector selection represents a critical initial consideration—mammalian expression vectors with epithelial-appropriate promoters (such as CMV or EF1α) typically provide suitable expression levels, though inducible systems (tetracycline-responsive) offer advantages for studying dose-dependent effects and avoiding potential toxicity from constitutive overexpression. For CLDN6 knockdown, researchers should design multiple siRNA sequences or shRNAs targeting different regions of the CLDN6 transcript, focusing on unique sequences not shared with other claudins, particularly CLDN9. Control constructs must include both empty vector controls (for overexpression) and non-targeting siRNAs (for knockdown) that undergo identical transfection procedures. Verification of manipulation efficiency is essential through both qRT-PCR (mRNA levels) and Western blotting or immunostaining (protein levels), with particular attention to potential compensatory changes in other claudin family members. For functional readouts, researchers should include multiple assays addressing different aspects of CLDN6 biology—barrier function (transepithelial electrical resistance, permeability assays), cell behavior (proliferation, migration, invasion), and molecular interactions (co-immunoprecipitation, proximity ligation assay). Rescue experiments represent a critical validation approach, where the phenotypes observed after knockdown are reversed by re-expressing an siRNA-resistant CLDN6 construct, confirming specificity of the observed effects.

What cell line models are most appropriate for studying CLDN6 function in different research contexts?

Selecting appropriate cell line models for CLDN6 research requires matching specific model characteristics to the particular aspects of CLDN6 biology under investigation. For studying CLDN6's basic tight junction functions, epithelial cell lines with well-characterized junctional complexes are optimal—MDCK (canine kidney), Caco-2 (human intestinal), or 16HBE (human bronchial) cells form coherent monolayers with measurable barrier properties, allowing functional assessment of CLDN6 contributions to paracellular permeability. Cancer research applications typically employ cell lines derived from CLDN6-positive tumors, including PA-1 or OVCAR-3 (ovarian cancer) and NTERA-2 (testicular cancer), though researchers should verify CLDN6 expression levels through Western blotting or flow cytometry, as expression can vary with passage number or culture conditions. For mechanistic studies of CLDN6 in HCV infection, Huh7 or Huh7.5 hepatic cell lines represent established models, allowing manipulation of CLDN6 levels to assess effects on viral entry efficiency. When studying CLDN6 trafficking and localization, polarized epithelial models grown on permeable supports (Transwell systems) provide the apical-basolateral differentiation necessary for proper tight junction formation and localization. For immunotherapy development, researchers should select cell lines with appropriate HLA haplotypes that can present CLDN6-derived peptides, such as HLA-A2-positive cell lines for developing TCR-based therapies targeting specific CLDN6 epitopes.

How should researchers design experiments to assess CLDN6's role in tight junction formation and barrier function?

Assessing CLDN6's contributions to tight junction assembly and barrier function requires systematic experimental approaches that measure multiple aspects of epithelial barrier properties. Transepithelial electrical resistance (TEER) measurements provide quantitative assessment of tight junction integrity—researchers should culture cells on permeable supports (Transwell inserts with 0.4 μm pore size) and measure resistance using chopstick electrodes or more advanced impedance-based systems, with measurements taken at multiple time points to capture the dynamic process of junction formation. Paracellular permeability assays complement TEER by measuring the passage of size-selective tracers (FITC-dextrans of varying molecular weights, typically 4-70 kDa) across the cell monolayer, providing insights into the size selectivity aspects of the barrier influenced by CLDN6. Calcium switch assays, where extracellular calcium is temporarily depleted and then restored, enable the study of de novo tight junction assembly dynamics, with immunofluorescence imaging at defined time points revealing CLDN6's incorporation into reforming junctions. Freeze-fracture electron microscopy offers high-resolution visualization of tight junction strand networks, allowing researchers to assess how CLDN6 manipulation affects the architectural complexity of junction strands. For molecular mechanism studies, co-immunoprecipitation combined with mass spectrometry can identify CLDN6 interaction partners within junction complexes, while FRAP (Fluorescence Recovery After Photobleaching) analyses of fluorescently-tagged CLDN6 can reveal protein dynamics within established junctions. Researchers should include both gain-of-function (CLDN6 overexpression) and loss-of-function (knockdown/knockout) approaches in their experimental design to comprehensively characterize CLDN6's barrier contributions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.