Recombinant Human Claudin-8 (CLDN8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. Please specify your preferred format in your order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on your purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped standard with blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
CLDN8; UNQ779/PRO1573; Claudin-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CLDN8
Target Protein Sequence
MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANI RMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILL TAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGA LFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
Uniprot No.

Target Background

Function
Claudin-8 is a tight-junction protein essential for paracellular chloride transport in the kidneys. It facilitates the recruitment of CLDN4 to tight junctions in the kidney. Claudins play a critical role in the tight junction-specific obliteration of the intercellular space, achieving this through calcium-independent cell-adhesion activity.
Gene References Into Functions

References

  1. This study highlighted the distinct expression profiles of claudin 5, 7, and 8 in nonneoplastic mucosal tissues and gastric carcinoma tissues. Moreover, the expression of these claudin proteins was significantly associated with metastatic progression and prognosis in patients with gastric carcinoma PMID: 29901188
  2. Data supports that the tight junction protein claudin 8 exon 1 is a predictor for plasma levels of IP-10 in patients with morphine-positive urine tests PMID: 29145422
  3. These findings indicate that CLDN8 functions as a downstream signal of the androgen receptor, facilitating the progression of prostate cancer PMID: 28474805
  4. The study suggests a new mechanistic pathway in inflammatory bowel disease, where MiR-223 acts as a proinflammatory molecule targeting CLDN8 in the IL23 pathway. PMID: 27029486
  5. High Claudin 8 contributes to malignant proliferation in osteosarcoma. PMID: 26560196
  6. The expression of claudin-5 and claudin-9 was downregulated, while the expression of claudin-8 was upregulated in cervical carcinoma tissues compared to adjacent non-neoplastic tissues. PMID: 26464708
  7. Human Cldn-8 and -14 were shown to convey Clostridium perfringens enterotoxin-mediated cytotoxicity at physiologically relevant concentrations, although at a lower efficiency than Cldn-4. PMID: 23322640
  8. Claudin-7 and claudin-8 have potential utility as immunohistochemical biomarkers for the differential diagnosis of chromophobe renal cell carcinoma and oncocytoma PMID: 18799195
  9. Sodium absorption is paralleled by claudin-8-mediated sealing of the paracellular barrier to prevent sodium back-leakage, supporting steep sodium gradients in the distal colon. PMID: 19000657
  10. The combination of CK7, S100A1, and claudin 8 immunohistochemistry can be valuable for classifying tumors of overlapping histology as chromophobe renal cell carcinoma or renal oncocytomas. PMID: 19302533
  11. CLDN8, clustered with CLDN17 on human chromosome 21q22.11, is a four-transmembrane protein characterized by a WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. PMID: 12736707

Show More

Hide All

Database Links

HGNC: 2050

OMIM: 611231

KEGG: hsa:9073

STRING: 9606.ENSP00000286809

UniGene: Hs.162209

Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the epididymis, mainly in the caput segment.

Q&A

What is the basic function of Claudin-8 (CLDN8) in cellular physiology?

CLDN8 functions as a critical component of tight junction strands which are integral to maintaining cell-to-cell adhesion in epithelial tissues . Unlike some claudins, CLDN8 cannot form tight junction strands independently, but rather associates with other claudin family members to regulate tight junction structural and functional dynamics .

CLDN8 plays a particularly important role in renal physiology, where it may coassemble with CLDN4 into tight junction strands containing anion-selective channels that convey paracellular chloride permeability in renal collecting ducts . This specialized function contributes to proper ion homeostasis and fluid balance in the kidney.

How does CLDN8 protein structure relate to its function?

CLDN8, like other claudin family members, has four transmembrane domains with two extracellular loops that are critical for tight junction formation. The structural organization of CLDN8 can be inferred from proteolytic cleavage studies. When subjected to cleavage by bacterial serine protease HtrA, the full-length GST-tagged claudin-8 protein (51 kDa) is cleaved into a carboxy-terminal 18-kDa fragment and a 33-kDa amino-terminal fragment (containing the GST-tag plus the 8-kDa amino-terminus of claudin-8) .

This cleavage pattern suggests that the C-terminal domain of CLDN8 is relatively large and potentially important for protein-protein interactions and signaling functions. The cleavage site is likely located in an accessible extracellular region, highlighting potential vulnerability during pathogenic infection processes .

What experimental approaches can verify CLDN8 localization in cells?

Several complementary approaches can be used to verify CLDN8 localization:

  • Immunohistochemistry (IHC): Formalin-fixed, paraffin-embedded tissues can be labeled with CLDN8-specific antibodies (such as ab211439 at 1/75 dilution) to visualize protein distribution in tissue sections .

  • Immunofluorescence microscopy: This provides higher resolution of CLDN8 localization at tight junctions and enables co-localization studies with other junction proteins.

  • Cell fractionation followed by Western blotting: This approach can biochemically determine the membrane association of CLDN8, with antibodies such as ab211439 at 1/1000 dilution proven effective for Western blot detection .

  • Flow cytometry (intracellular): For quantitative assessment of CLDN8 expression levels in cell populations, particularly useful when comparing different experimental conditions .

Each method provides complementary information about CLDN8 localization, with the choice dependent on the specific research question being addressed.

How is CLDN8 expression regulated in normal tissues versus pathological conditions?

CLDN8 shows tissue-specific expression patterns with notable expression in kidney and colon tissues under normal physiological conditions . In pathological conditions, particularly in kidney renal clear cell carcinoma (KIRC), CLDN8 expression is significantly downregulated compared to normal kidney tissue .

This downregulation has been consistently observed across multiple independent datasets. A comprehensive meta-analysis of 20 independent mRNA expression datasets (totaling 1,096 KIRC and 487 non-KIRC control tissue specimens) demonstrated significant downregulation of CLDN8 in KIRC tissues with a standardized mean difference of -5.25 (95% confidence interval: -6.13 to -4.37) .

What signaling pathways interact with or regulate CLDN8?

Several key signaling pathways appear to interact with CLDN8:

  • Epithelial-Mesenchymal Transition (EMT) Pathway: CLDN8 has been shown to suppress cancer cell proliferation, migration, and invasion through modulation of the EMT pathway . This suggests that CLDN8 may help maintain the epithelial phenotype, with its downregulation potentially contributing to EMT-mediated cancer progression.

  • AKT Pathway: Research indicates that CLDN8 suppresses the AKT signaling pathway in 786-O ccRCC cells . The AKT pathway is a central regulator of cell growth, proliferation, and survival, suggesting that CLDN8 may function as a tumor suppressor by inhibiting this pro-growth signaling.

  • Gene Set Enrichment Analysis (GSEA) has been used to identify additional biological pathways associated with CLDN8 expression in ccRCC , though specific pathway details weren't fully elaborated in the available search results.

Understanding these pathway interactions provides insight into how CLDN8 contributes to normal epithelial function and how its dysregulation might contribute to pathological conditions.

What methodologies effectively measure CLDN8 expression changes in experimental studies?

Researchers studying CLDN8 expression changes can employ several complementary methodologies:

  • Quantitative RT-PCR: For measuring CLDN8 mRNA levels using specific primers (forward: 5ʹ-CCGCTCGAGGCCACCATGGCAACCCATGCCTTAG-3ʹ; reverse: 5ʹ-CGGGATCCCTACACATACTGACTTCTGGAGTAGAC-3ʹ) .

  • Western blotting: For protein expression quantification using antibodies such as rabbit α-claudin-8 (#710222, Invitrogen) or ab211439 (Abcam) at 1/1000 dilution .

  • Immunohistochemistry: For spatial visualization of expression changes in tissue sections .

  • High-throughput transcriptomic analysis: For comprehensive examination across multiple samples, as demonstrated in studies analyzing CLDN8 expression using data from GEO, ArrayExpress, SRA, and TCGA databases .

  • Single-cell analysis: For examining expression heterogeneity within tissues, especially valuable in cancer studies where cellular composition may vary significantly .

When designing expression studies, researchers should incorporate appropriate housekeeping genes or proteins (such as GAPDH) as internal controls and consider the specific characteristics of their experimental system when selecting methods.

What is the evidence for CLDN8 as a prognostic biomarker in renal cell carcinoma?

Substantial evidence supports CLDN8's potential as a prognostic biomarker in renal cell carcinoma:

These findings collectively support CLDN8's potential as both a diagnostic and prognostic biomarker for renal cell carcinoma.

How does CLDN8 influence cancer cell behavior and what mechanisms are involved?

CLDN8 appears to act as a tumor suppressor in clear cell renal cell carcinoma, influencing several aspects of cancer cell behavior:

  • Proliferation inhibition: CLDN8 suppresses the proliferation of 786-O ccRCC cells through modulation of the AKT signaling pathway . The AKT pathway is a key regulator of cell proliferation and survival, suggesting that CLDN8 may inhibit cancer cell growth by dampening pro-proliferative signaling.

  • Migration and invasion suppression: Experimental evidence indicates that CLDN8 inhibits the migration and invasion of 786-O ccRCC cells . This function appears to be mediated, at least in part, through effects on the epithelial-mesenchymal transition (EMT) pathway.

  • EMT regulation: CLDN8 suppresses EMT, a critical process in cancer progression that enables epithelial cells to acquire more invasive and migratory properties . By helping maintain the epithelial phenotype, CLDN8 may prevent the acquisition of mesenchymal traits associated with cancer progression.

  • Wound healing modulation: Wound healing assays with 786-O cells demonstrated that CLDN8 influences cell migration during wound closure , further supporting its role in regulating cancer cell motility.

The downregulation of CLDN8 observed in ccRCC may therefore contribute to enhanced proliferation, migration, and invasion of cancer cells through disinhibition of the AKT pathway and promotion of EMT.

What experimental approaches can be used to study CLDN8's role in cancer progression?

Researchers investigating CLDN8's role in cancer progression can employ several experimental approaches:

  • Expression manipulation:

    • Overexpression using lentiviral vectors: CLDN8 can be cloned into expression vectors (such as pLVX) and delivered via lentiviral transduction. Stable expression can be achieved by selection with antibiotics like blasticidin (5 μg/mL) .

    • Knockdown/knockout: CRISPR-Cas9 technology can be used for CLDN8 knockout, as suggested by mentions of "clustered regularly interspaced short palindromic repeats knockout screen analysis" .

  • Functional assays:

    • Proliferation assays to assess growth effects

    • Wound healing assays to evaluate migration (observations at specific timepoints, e.g., 0, 6, and 24 hours)

    • Transwell invasion assays to assess invasive capacity

    • Colony formation assays to examine clonogenic potential

  • Mechanistic studies:

    • Western blotting for signaling pathway analysis, particularly examining the EMT and AKT pathways

    • Gene set enrichment analysis (GSEA) to identify biological pathways associated with CLDN8 expression

    • Correlation analyses to identify genes positively or negatively correlated with CLDN8 (correlation coefficient thresholds of >0.30 or <-0.30, P<0.05)

  • In vivo models:

    • Xenograft models with CLDN8-manipulated cell lines to assess tumor growth and metastasis

    • Patient-derived xenografts to study CLDN8 in a more clinically relevant context

These complementary approaches can provide comprehensive insights into CLDN8's role in cancer progression.

How can recombinant CLDN8 proteins be used in structural and functional studies?

Recombinant CLDN8 proteins serve as valuable tools for various structural and functional investigations:

  • Structural analysis:

    • Recombinant Human Claudin 8 protein (ab160326) can be used for structural characterization using techniques like circular dichroism or X-ray crystallography .

    • GST-tagged claudin-8 provides a stable, purifiable form of the protein that maintains functional domains .

  • Interaction studies:

    • Pull-down assays using GST-tagged CLDN8 can identify binding partners within tight junction complexes

    • Surface plasmon resonance or isothermal titration calorimetry can quantify binding affinities with potential interactors

  • Enzymatic assays:

    • In vitro cleavage assays with recombinant GST-tagged claudin-8 (rGST-Claudin-8, about 51 kDa) can be used to study proteolytic processing by enzymes like bacterial HtrA .

    • Fragment analysis following cleavage can identify specific cleavage sites and functional domains within CLDN8

  • Antibody development:

    • Recombinant CLDN8 proteins can serve as immunogens for developing specific antibodies

    • Epitope mapping using protein fragments can characterize antibody specificity

  • Reconstitution experiments:

    • Purified recombinant CLDN8 can be incorporated into artificial membrane systems to study its contribution to paracellular permeability

When selecting recombinant CLDN8 protein for specific applications, researchers should consider factors like the expression system used, purification methods, tag presence, and whether post-translational modifications are present or required.

What is known about CLDN8 interactions with pathogens and their virulence factors?

The interaction between CLDN8 and pathogens represents an emerging area of research with important implications for infectious disease mechanisms:

  • Campylobacter jejuni targeting of CLDN8:

    • C. jejuni secretes a serine protease called HtrA that directly cleaves CLDN8 .

    • In vitro cleavage assays demonstrated that purified C. jejuni HtrA cleaves recombinant GST-tagged claudin-8 into specific fragments: a carboxy-terminal 18-kDa fragment and a 33-kDa amino-terminal fragment (containing the GST-tag plus the 8-kDa amino-terminal fragment) .

    • This proteolytic targeting likely disrupts tight junction integrity, potentially contributing to the breakdown of epithelial barriers during C. jejuni infection.

  • Cleavage site identification:

    • WebLogo and ScanProsite analysis has been used to identify potential HtrA cleavage sites in claudin-8 .

    • Structural modeling of claudin-8 using HHpred and Modeller with claudin-9 as a template helps visualize these cleavage sites in the context of the protein's three-dimensional structure .

  • Functional consequences:

    • Cleavage of CLDN8 by bacterial proteases may compromise epithelial barrier function

    • Disruption of tight junctions through CLDN8 targeting could facilitate bacterial invasion and dissemination

This pathogen-CLDN8 interaction represents a specific example of how bacteria can target tight junction proteins to breach epithelial barriers, a critical step in the pathogenesis of many infectious diseases.

How does CLDN8 contribute to tight junction formation and barrier function?

CLDN8 plays specialized roles in tight junction formation and barrier function:

  • Co-assembly with other claudins:

    • CLDN8 associates with other claudins to regulate tight junction structural and functional strand dynamics .

    • It notably coassembles with CLDN4 into tight junction strands containing anion-selective channels .

    • Unlike some claudin family members, CLDN8 cannot form tight junction strands independently , highlighting its cooperative function within the junction complex.

  • Ion selectivity regulation:

    • CLDN8-containing tight junctions convey paracellular chloride permeability in renal collecting ducts .

    • This selective permeability is crucial for proper ion homeostasis and fluid balance in the kidney.

  • Barrier integrity impact:

    • Downregulation of CLDN8 in pathological conditions like cancer may compromise barrier function.

    • Bacterial proteases like HtrA can cleave CLDN8, potentially disrupting barrier integrity during infection .

  • Epithelial phenotype maintenance:

    • CLDN8 appears to help maintain the epithelial phenotype, as suggested by its role in suppressing epithelial-mesenchymal transition (EMT) in cancer cells .

    • Loss of CLDN8 may contribute to reduced cell-cell adhesion and altered paracellular transport.

Understanding CLDN8's contribution to barrier function has implications for various physiological processes and pathological conditions, including ion transport disorders, cancer progression, and infection susceptibility.

What molecular techniques can identify CLDN8 protein-protein interactions and signaling networks?

Several complementary techniques can elucidate CLDN8's protein interactions and signaling networks:

  • Affinity-based methods:

    • Co-immunoprecipitation using CLDN8-specific antibodies like rabbit α-claudin-8 (#710222, Invitrogen)

    • GST pull-down assays utilizing recombinant GST-tagged CLDN8 proteins

    • Proximity labeling techniques like BioID or APEX to identify proteins in close proximity to CLDN8 in living cells

  • Correlation and bioinformatic approaches:

    • Gene correlation analyses to identify genes positively or negatively correlated with CLDN8 expression (correlation coefficient thresholds >0.30 or <-0.30, P<0.05)

    • Functional enrichment analysis using databases like Metascape to identify biological pathways associated with CLDN8-correlated genes

  • Pathway analysis techniques:

    • Western blotting with phospho-specific antibodies to examine how CLDN8 manipulation affects signaling pathways like AKT

    • Single-sample gene set enrichment analysis to explore effects on broader pathway activation

  • Microscopy-based interaction studies:

    • Immunofluorescence co-localization to visualize CLDN8 associations with other junction proteins

    • Fluorescence resonance energy transfer (FRET) to detect direct protein-protein interactions

    • Proximity ligation assay (PLA) to visualize protein interactions with high sensitivity

  • Proteomic approaches:

    • Mass spectrometry analysis of CLDN8 immunoprecipitates to identify binding partners

    • Stable isotope labeling with amino acids in cell culture (SILAC) to quantitatively compare protein interactions under different conditions

These techniques, used in combination, can provide a comprehensive view of CLDN8's interaction network and its role in cellular signaling.

What methods are most effective for CLDN8 overexpression in experimental models?

Based on published methodologies, several approaches can be used for effective CLDN8 overexpression:

  • Lentiviral vector systems:

    • The pLVX vector system has been successfully used for CLDN8 overexpression .

    • PCR amplification of CLDN8 with specific primers incorporating appropriate enzyme sites (XhoI and BamHI) enables efficient cloning:

      • Forward primer: 5ʹ-CCGCTCGAGGCCACCATGGCAACCCATGCCTTAG-3ʹ

      • Reverse primer: 5ʹ-CGGGATCCCTACACATACTGACTTCTGGAGTAGAC-3ʹ

    • Lentiviral transformation at multiplicity of infection (MOI) = 50 provides efficient delivery .

    • Stable expression can be achieved through antibiotic selection (e.g., blasticidin at 5 μg/mL) .

  • Verification strategies:

    • Sequencing verification of the recombinant plasmid is essential before virus packaging .

    • Western blotting using CLDN8-specific antibodies can confirm protein expression levels.

    • Immunofluorescence microscopy can verify proper localization to cell-cell junctions.

  • Considerations for experimental design:

    • Cell type selection is crucial - epithelial cell lines that form tight junctions are preferred for functional studies.

    • Expression level titration may be necessary, as excessive overexpression could disrupt normal tight junction architecture.

    • Inducible expression systems can provide temporal control over CLDN8 expression.

This methodological approach enables researchers to study the functional consequences of CLDN8 overexpression in various experimental contexts.

How can researchers effectively analyze CLDN8 expression in single-cell studies?

Single-cell analysis of CLDN8 requires specialized approaches to capture expression heterogeneity:

  • Single-cell RNA sequencing (scRNA-seq):

    • Enables comprehensive analysis of CLDN8 mRNA expression at single-cell resolution .

    • Can reveal cell type-specific expression patterns not detectable in bulk tissue analysis.

    • Particularly valuable in heterogeneous tissues like tumors, where CLDN8 expression may vary between different cell populations.

  • Analytical pipelines:

    • Quality control filtering to remove low-quality cells or doublets.

    • Normalization to account for technical variation in sequencing depth.

    • Dimensional reduction techniques (e.g., t-SNE, UMAP) to visualize cell populations.

    • Clustering algorithms to identify cell types or states with distinct CLDN8 expression profiles.

  • Validation techniques:

    • Single-molecule RNA fluorescence in situ hybridization (smFISH) can validate scRNA-seq findings with spatial context.

    • Single-cell Western blotting or mass cytometry can assess CLDN8 protein expression in individual cells.

  • Integration with spatial information:

    • Spatial transcriptomics methods can map CLDN8 expression within the tissue architecture.

    • This is particularly important for tight junction proteins, whose function depends on their localization at cell-cell contacts.

  • Computational approaches:

    • Trajectory analysis can reveal dynamic changes in CLDN8 expression during processes like EMT.

    • Cell-cell interaction analyses can identify relationships between CLDN8-expressing cells and their neighbors.

These approaches provide unprecedented resolution of CLDN8 expression patterns, enabling researchers to understand its heterogeneity in both normal and disease contexts.

What are the critical methodological considerations when assessing CLDN8 in clinical samples?

When analyzing CLDN8 in clinical samples, researchers should consider several critical methodological aspects:

  • Sample handling and processing:

    • Proper tissue fixation is essential for IHC analysis - formalin-fixed, paraffin-embedded tissues have been successfully used with CLDN8 antibodies at 1/75 dilution .

    • For protein extraction, protocols must preserve membrane proteins like CLDN8 that can be difficult to solubilize.

    • RNA preservation is critical for transcriptomic analysis - RNAlater or snap-freezing are preferable methods.

  • Expression analysis techniques:

    • Immunohistochemistry provides spatial context and is suitable for clinical samples .

    • Tissue microarrays enable high-throughput analysis across multiple patient samples .

    • RT-qPCR with validated primer sets offers quantitative mRNA expression assessment.

    • Western blotting can detect CLDN8 protein levels and potential cleavage products .

  • Statistical considerations:

    • Appropriate sample size determination based on power analysis.

    • Standardized mean difference (SMD) calculation for comparing CLDN8 expression between groups .

    • Receiver operating characteristic (ROC) curve analysis to evaluate diagnostic potential .

    • Kaplan-Meier survival analysis with appropriate statistical tests to assess prognostic value .

  • Validation approaches:

    • Multiple independent cohorts should be analyzed to ensure reproducibility .

    • Meta-analysis techniques can integrate data across studies - forest plots and SROC curves effectively visualize consolidated findings .

    • Publication bias assessment using Egger's test and Begg's test should be conducted .

  • Interpretation frameworks:

    • Correlation with clinical parameters enhances translational relevance.

    • Multivariate analysis controls for confounding factors when assessing CLDN8's independent prognostic value .

    • Integration with other molecular markers may provide more comprehensive clinical information.

These methodological considerations ensure robust, reproducible, and clinically relevant CLDN8 assessment in patient samples.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.