Recombinant Human Claudin domain-containing protein 2 (CLDND2)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CLDND2 is a 167-amino acid multi-pass transmembrane protein belonging to the PMP-22/EMP/MP20 family. It is encoded by the CLDND2 gene located on human chromosome 19q13.33 and shares 45–55% sequence identity with rodent orthologs . Unlike classical claudins (e.g., CLDN2), CLDND2 contains a claudin-like domain but lacks canonical tight junction functions .

Recombinant Production

CLDND2 is expressed in heterologous systems for structural and functional studies. Common platforms include:

Functional Insights

While CLDND2’s exact physiological role remains unclear, its homology to claudins suggests involvement in:

  • Paracellular Transport: Potential regulation of ion or small molecule flux across epithelial barriers .

  • Membrane Organization: Participation in high molecular weight complexes, as observed in claudin-2 studies .

Comparative Analysis with Claudin-2 (CLDN2):

FeatureCLDND2CLDN2
Tight Junction RoleIndirect evidenceForms cation-selective channels
Calcium TransportNot characterizedCritical for vitamin D-mediated Ca²⁺ absorption
OligomerizationSuspected dimerizationForms homodimers via TM2 domains

Research Applications

CLDND2 recombinant proteins are primarily used for:

  • Antibody Development: Fragments (e.g., aa 78–99) serve as immunogens or controls in IHC/WB .

  • Mechanistic Studies: Investigating its role in hepatitis C pathways and membrane protein interactions .

  • Structural Biology: Full-length variants with isotopic labeling (C13/N15) enable NMR studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
CLDND2; Claudin domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CLDND2
Target Protein Sequence
MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLA VTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAW KNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL
Uniprot No.

Target Background

Database Links

HGNC: 28511

KEGG: hsa:125875

STRING: 9606.ENSP00000291715

UniGene: Hs.720536

Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant CLDND2?

Recombinant expression of claudin family proteins often presents challenges due to their multiple transmembrane domains. Based on experiences with related claudin proteins, researchers should consider:

Expression SystemAdvantagesConsiderations
Mammalian (HEK293T, CHO)Native folding and post-translational modificationsLower yield, higher cost
Insect cells (Sf9, High Five)Higher yield than mammalian, proper foldingGlycosylation patterns differ from human
E. coliHigh yield, cost-effectiveRefolding often required, lacks PTMs
Cell-free systemsRapid production, membrane protein-friendlyScaling challenges, cost

For transmembrane proteins like CLDND2, lentiviral expression systems offer particular advantages due to their high transduction efficiency, especially in cells with poor transfection capabilities .

What are the recommended methods for detecting endogenous CLDND2 expression?

Detection of endogenous CLDND2 requires validated tools and appropriate controls:

  • qRT-PCR approach:

    • Design primers specific to CLDND2 (Accession Number: NM_152353.3)

    • Include reference genes appropriate for your tissue/cell type

    • Validate primer specificity through melt curve analysis and sequencing

  • Protein detection:

    • Western blotting with validated antibodies

    • Immunofluorescence for localization studies

    • For antibody validation, use CRISPR-generated knockout cells as negative controls

What CRISPR-Cas9 strategies are most effective for CLDND2 gene editing?

CRISPR-Cas9 provides powerful tools for CLDND2 functional studies. Commercially available sgRNA CRISPR/Cas9 All-in-One Lentivector sets targeting human CLDND2 include three separate sgRNA targets designed to induce frameshift mutations and gene knockout .

For optimal CLDND2 editing:

  • Consider lentiviral delivery methods for cells with low transfection efficiency

  • Aim for MOI optimization up to 10 with infection duration up to 72 hours

  • Validate editing efficiency via Surveyor assay and Sanger sequencing

  • Conduct clone screening to identify complete knockouts

  • Expect >50% knockout efficiency after selection

How can protein-protein interactions of CLDND2 be rigorously investigated?

To investigate CLDND2 interactions and potential homodimerization:

  • Cross-linking strategies:

    • Photo-activated cross-linkers (NHS-diazirine, NHS-LC-diazirine, or Sulfo-NHS-SS-diazirine) at 2mM concentration

    • For cysteine-specific cross-linking, consider dithiobismaleimidoethane (DTME) at 2mg/ml

    • UV exposure at 350nm for controlled time periods

  • BN-PAGE analysis:

    • Extract protein complexes using non-ionic detergents

    • Run samples on native gels to preserve protein-protein interactions

    • Combine with Western blotting for complex identification

  • Co-immunoprecipitation:

    • Use epitope-tagged CLDND2 constructs if antibody availability is limited

    • Include appropriate controls to rule out non-specific binding

What approaches should be used to investigate CLDND2 in the context of mitochondrial function?

The connection between claudin proteins and mitochondrial function represents an emerging research area. Drawing from approaches used in related studies:

  • Mitochondrial morphology assessment:

    • Use fluorescence microscopy with mitochondrial markers

    • Quantify mitochondrial network parameters (length, branching, fragmentation)

    • Compare wild-type and CLDND2-knockout or overexpressing cells

  • Mitochondrial function evaluation:

    • Measure mitochondrial membrane potential

    • Assess superoxide production using fluorescent probes

    • Evaluate oxidized mitochondrial DNA (oxmtDNA) content via dot-blot

  • Metabolism analysis:

    • Consider 13C glucose uptake assays to assess cellular metabolism

    • Investigate potential metabolic shifts upon CLDND2 manipulation

How can local genetic covariance analysis be applied to understand CLDND2's relationship with disease phenotypes?

To investigate potential disease associations of CLDND2:

  • Identify genomic windows:

    • Define LD windows surrounding CLDND2 SNPs with correlation threshold ≥0.1

    • Include core segments and overlapping flanking buffers

  • Calculate local variances and covariances:

    • Use Bayesian multitrait models to analyze markers

    • Compute (co)variances within LD windows

    • Generate posterior mean estimates and 95% posterior CRs

  • Validate findings:

    • Replicate analysis in independent cohorts

    • Use COLOC to assess if significant eQTLs colocalize with trait signals

    • Consider H4 posterior probability of colocalization (PPC) ≥0.5 for both traits

What controls are essential when performing CLDND2 knockout experiments?

When conducting CLDND2 knockout studies:

  • Essential controls:

    • Mock-transfected/transduced cells

    • Non-targeting sgRNA control

    • Wild-type Cas9 control without sgRNA

    • Positive control targeting a well-characterized gene

  • Validation approaches:

    • Surveyor or T7E1 assays to detect indels

    • Sanger sequencing of the targeted region

    • Western blot confirmation of protein loss

    • Phenotypic rescue with wild-type CLDND2 expression

How should contradictory findings in CLDND2 research be approached methodologically?

When facing contradictory results:

  • Consider tissue/cell-specific effects:

    • Different cell types may show divergent CLDND2 functions

    • Local genetic effects may differ from global patterns

  • Validate with multiple methodologies:

    • Combine genetic approaches with biochemical validation

    • Use complementary techniques to confirm findings

  • Investigate potential confounding factors:

    • Examine expression of related claudin proteins

    • Consider the impact of experimental conditions

    • Evaluate potential differences in post-translational modifications

What are the optimal methods for producing and purifying recombinant CLDND2 for structural studies?

For structural and biochemical studies requiring purified protein:

  • Expression optimization:

    • Consider fusion tags to enhance solubility (MBP, SUMO, TrxA)

    • For membrane proteins like CLDND2, insect cell or mammalian expression may provide better folding

  • Purification approach:

    • Two-step affinity purification (e.g., His-tag followed by size exclusion)

    • Carefully optimize detergent selection for membrane protein extraction

    • Consider nanodisc or amphipol reconstitution for stability

  • Quality control:

    • Assess protein homogeneity via dynamic light scattering

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to optimize buffer conditions

How can humanized antibody approaches be applied to CLDND2 research?

Developing targeted antibodies against CLDND2:

  • VHH-based approaches:

    • Consider strategies similar to those used for other claudin family members

    • Bio-panning techniques can identify high-affinity binders

    • Framework region 2 (FR2) modifications may improve antibody properties

  • Humanization considerations:

    • Compare with conventional VH regions for optimal humanization

    • Note substitution patterns observed in other claudin-targeting antibodies

    • Consider hydrophilic amino acid substitutions at key positions

What methodological approaches should be used to investigate potential roles of CLDND2 in inflammatory pathways?

To explore CLDND2 in inflammation contexts:

  • Gene expression analysis:

    • Examine correlation between CLDND2 and inflammatory gene signatures

    • Consider RNA-seq to identify co-regulated pathways

  • Functional studies:

    • Measure impact of CLDND2 manipulation on cytokine production

    • Assess effects on interferon-stimulated gene (ISG) expression

  • Intervention approaches:

    • Consider inhibitors of relevant pathways (e.g., cGAS inhibitors, TLR antagonists)

    • Evaluate antioxidants like N-acetyl cysteine (NAC) to modulate oxidative stress

What are the best approaches to investigate potential redundancy between CLDND2 and other claudin family proteins?

To address functional redundancy:

  • Comparative genomic analysis:

    • Sequence alignment to identify conserved domains

    • Phylogenetic analysis to determine evolutionary relationships

  • Expression profiling:

    • Tissue-specific co-expression patterns

    • Compensatory expression changes in knockout models

  • Experimental validation:

    • Double/multiple knockout approaches

    • Domain swapping experiments between claudin family members

    • Rescue experiments with related claudins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.