Recombinant Human CMT1A duplicated region transcript 15 protein-like protein (CDRT15L2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
CDRT15L2; CMT1A duplicated region transcript 15 protein-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CDRT15L2
Target Protein Sequence
MFSCCFPTSRGCCFRNGGSESLFRQCRRRLIPHPRRLWPFVRRRTQVPQDSPGQALAGQA TPEIPSGLPLHIVLVQEEIREPMEAQTHAPGPYADIAALAAPAVEPKPAWEEPPPERALE VEGAPAKDQPSQELPEIMAPTVATGLNAGAENVAGERSGREGVTSTAPASRSHAAPSPGH GGKHGGGDQGIQTGLLYLAGERLLSFAGTTALLLQGLFIVLILVGYISVKVMLKSIKTRL GRRVPAAPPALRRNLLLQAWKCVCNWASRLFAPNVLPRTGS
Uniprot No.

Target Background

Database Links

HGNC: 34075

KEGG: hsa:256223

STRING: 9606.ENSP00000382000

UniGene: Hs.131916

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CDRT15L2 and how does it relate to CDRT15?

CDRT15L2 (CMT1A Duplicated Region Transcript 15-Like 2) is a protein-coding gene related to CDRT15. While CDRT15L2 remains less characterized in the literature, CDRT15 has been identified as a potential biomarker in certain cancers, particularly cholangiocarcinoma (CCA). Both genes are part of the CMT1A duplicated region, which was initially identified in relation to Charcot-Marie-Tooth disease type 1A. The CDRT15 protein consists of 188 amino acids in its primary sequence and has been studied for its potential roles in cellular pathways and disease processes .

What methods are used to detect sequence variants in CDRT15L2?

Next-generation sequencing (NGS) is the primary methodology for detecting sequence variants in CDRT15L2. This approach can detect both sequence variants and copy number variants (deletions/duplications) with greater than 99% sensitivity. In clinical settings, variants are typically classified as variants of unknown significance (VUS), likely pathogenic, or pathogenic. Benign and likely benign variants are generally not reported in clinical testing scenarios. For comprehensive genetic analysis, clinical exome or whole exome sequencing may be used as reflexive testing approaches when targeted gene analysis is insufficient .

What experimental systems are used to produce recombinant CDRT15 proteins?

Recombinant CDRT15 proteins are commonly produced using mammalian expression systems, particularly HEK-293 cells. This expression system is preferred because it provides proper post-translational modifications that are essential for maintaining the protein's native structure and function. The expressed proteins are typically tagged (e.g., with a His-tag) to facilitate purification through one-step affinity chromatography. The purified protein typically achieves >90% purity as determined by methods such as Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC (HPLC) .

How can researchers design effective experiments to investigate CDRT15L2 function?

When investigating CDRT15L2 function, researchers should consider implementing quasi-experimental designs that maximize internal validity. The following approach is recommended:

  • Begin with exploratory studies using one-group posttest-only or pretest-posttest designs (Design Notation: O₁ X O₂) to establish preliminary functional characteristics

  • Progress to more robust designs with control groups and pretests to strengthen causal inferences:

Quasi-experimental Study DesignDesign NotationApplication
Untreated control group with dependent pretest and posttest samplesIntervention group: O₁ₐ X O₂ₐ Control group: O₁ᵦ O₂ᵦComparing CDRT15L2 manipulation effects against control conditions
Untreated control group design with double pretestIntervention group: O₁ₐ O₂ₐ X O₃ₐ Control group: O₁ᵦ O₂ᵦ O₃ᵦEstablishing baseline stability before CDRT15L2 intervention
Switching replications designIntervention group: O₁ₐ X O₂ₐ O₃ₐ Control group: O₁ᵦ O₂ᵦ X O₃ᵦTesting reproducibility of CDRT15L2 effects across groups
  • For longitudinal studies on CDRT15L2 expression or function, consider interrupted time-series designs with multiple observation points (O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀)

What immune infiltration correlates have been observed with CDRT15 expression?

Spearman correlation analysis of CDRT15 expression levels and immune cell enrichment (generated by single-sample Gene Set Enrichment Analysis or ssGSEA) in the tumor microenvironment of cholangiocarcinoma has revealed significant relationships. CDRT15 expression was found to be negatively correlated with regulatory T cells (Tregs), dendritic cells (DCs), and cytotoxic cells (p < 0.05). These findings suggest that CDRT15 may be involved in the immune infiltration process of CCA, potentially influencing the tumor microenvironment through modulation of immune cell populations. This negative correlation with immune cells involved in anti-tumor responses might partially explain the association between high CDRT15 expression and poor prognosis in CCA patients .

How can researchers effectively analyze CDRT15L2 expression data across different cohorts?

For effective analysis of CDRT15L2 expression data across different cohorts, researchers should implement a multi-step analytical framework:

  • Data normalization and quality control:

    • Implement robust normalization methods to account for batch effects between different datasets

    • Perform Principal Component Analysis (PCA) to identify and mitigate technical variations

  • Statistical analysis approaches:

    • Apply multivariate Cox regression models to analyze survival correlations

    • Use Wilcoxon rank sum tests to compare expression between different clinical subgroups

    • Implement Fisher exact tests for categorical variable comparisons

  • Validation strategies:

    • Perform cross-validation across independent cohorts

    • Generate receiver operating characteristic (ROC) curves to assess diagnostic potential

    • Conduct Kaplan-Meier survival analyses with log-rank tests to verify prognostic value

It is critical to present both tabular data (for precise numerical comparisons) and graphical representations (for identifying patterns) in your analyses, as different visualization methods serve complementary purposes in data interpretation .

What are the challenges in identifying pathogenic variants in CDRT15L2?

Identifying pathogenic variants in CDRT15L2 presents several methodological challenges that researchers must address:

  • Classification ambiguity: Many detected variants fall into the "variant of unknown significance" (VUS) category, requiring additional functional studies to determine pathogenicity

  • Structural complexity: The genomic region containing CDRT15L2 may have complex structural variations that complicate sequencing and variant interpretation

  • Limited literature: The relative scarcity of functional studies on CDRT15L2 makes it difficult to apply evidence-based classification criteria

  • Heterogeneous expression: Expression levels may vary across tissues, complicating the interpretation of expression-based analyses

To address these challenges, researchers should employ a combination of computational prediction tools, functional assays, and population frequency data. When reporting variants, those classified as unknown significance (VUS), likely pathogenic, or pathogenic should be documented, while benign and likely benign variants can generally be excluded from detailed analysis unless they have potential functional significance .

How does CDRT15 expression correlate with clinicopathological features in cancer?

Analysis of CDRT15 expression in relation to clinicopathological features in cholangiocarcinoma has revealed several patterns, though not all correlations reached statistical significance. The table below summarizes these relationships:

Clinicopathological FeatureLow CDRT15 Expression (n=18)High CDRT15 Expression (n=18)P-valueStatistical Test
T stage (%)T1: 11 (61.1%)
T2: 4 (22.2%)
T3: 3 (16.7%)
T1: 8 (44.4%)
T2: 8 (44.4%)
T3: 2 (11.1%)
0.519Exact test
N stage (%)N0: 16 (94.1%)
N1: 1 (5.9%)
N0: 10 (71.4%)
N1: 4 (28.6%)
0.148Exact test
M stage (%)M0: 15 (88.2%)
M1: 2 (11.8%)
M0: 13 (81.2%)
M1: 3 (18.8%)
0.656Exact test
Pathologic stage (%)Stage I: 11 (61.1%)
Stage II: 4 (22.2%)
Stage I: 8 (44.4%)
Stage II: 5 (27.8%)
0.446Exact test

While these specific comparisons did not reach statistical significance (p < 0.05), the trend suggests that higher CDRT15 expression might be associated with more advanced N stage (lymph node involvement) and slightly higher rates of metastasis (M1). Further research with larger cohorts is needed to confirm these relationships and explore their biological significance .

What functional pathways are associated with CDRT15 expression?

Gene Set Enrichment Analysis (GSEA) performed on CDRT15 low-expression and high-expression datasets has identified multiple significant pathways associated with CDRT15 expression levels. The analysis revealed 13 data sets with FDR < 0.25 and adjusted p-value < 0.05 in the enriched MSigDB set (C2.all.v6.2.symbols). These pathways are primarily associated with:

  • Immune/inflammatory response processes

  • Cell cycle regulation

  • Signal transduction pathways

  • Metabolic processes

Gene Ontology (GO) enrichment analysis further elucidated the functions of CDRT15-related proteins, confirming their involvement in immune response pathways. These functional annotations provide valuable insights into the potential biological mechanisms through which CDRT15 may influence disease processes, particularly in cancer contexts where immune infiltration and inflammatory responses play crucial roles in tumor progression and patient outcomes .

How can researchers optimize recombinant CDRT15/CDRT15L2 protein production?

To optimize recombinant CDRT15/CDRT15L2 protein production for research applications, consider the following methodological approaches:

  • Expression system selection:

    • HEK-293 cells are preferred for maintaining proper post-translational modifications

    • Consider domain-specific expression if the full protein presents expression challenges

  • Protein purification strategy:

    • Implement one-step affinity chromatography using appropriate tags (e.g., His-tag)

    • Achieve >90% purity through optimized purification protocols

  • Quality control procedures:

    • Verify protein identity and purity using multiple complementary methods:

      • Bis-Tris PAGE for size verification

      • Anti-tag ELISA for quantification

      • Western Blot for specificity confirmation

      • Analytical SEC (HPLC) for purity assessment

  • Storage considerations:

    • Determine optimal buffer conditions for maintaining protein stability

    • Establish appropriate aliquoting and freeze-thaw protocols to preserve activity

For researchers not requiring full-length protein, consider expressing specific domains or fragments based on the research question, which may improve expression efficiency and protein stability .

What are the best statistical approaches for analyzing CDRT15L2 expression data?

When analyzing CDRT15L2 expression data, researchers should apply appropriate statistical methods based on their specific research questions. For differential expression analysis, Wilcoxon rank sum tests are appropriate for comparing expression between different groups (e.g., tumor vs. normal tissue). For survival analysis, implement Kaplan-Meier methods with log-rank tests to evaluate the impact of expression levels on patient outcomes.

Multivariate Cox regression analysis should be used to control for potential confounding variables, such as age, sex, and tumor stage. When examining correlations between CDRT15L2 expression and other continuous variables (e.g., immune cell infiltration levels), Spearman correlation analysis is recommended, especially when data may not follow normal distributions.

For visualizing and communicating results, consider both tabular representations (for precise numerical data) and graphical displays (for identifying patterns and trends). Each approach has distinct advantages in data presentation, with tables providing exact values and graphs facilitating pattern recognition across complex datasets .

How can researchers design experiments to investigate the removed-treatment effects of CDRT15L2?

To investigate the removed-treatment effects of CDRT15L2, researchers should consider implementing a specific quasi-experimental design with the notation: O₁ X O₂ O₃ removeX O₄

This design adds a third posttest measurement (O₃) to the standard one-group pretest-posttest design and then removes the intervention before taking a final measurement (O₄). The key advantage of this approach is that it allows testing of hypotheses about outcomes both in the presence and absence of the intervention.

For example, if CDRT15L2 is hypothesized to inhibit a specific cellular process, researchers would predict:

  • An increase in inhibition between O₁ and O₂ (after CDRT15L2 introduction)

  • Continued inhibition at O₃ (with CDRT15L2 still present)

  • Decrease in inhibition at O₄ (after CDRT15L2 removal)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.