Recombinant Human Coiled-coil domain-containing protein 56 (CCDC56)

Shipped with Ice Packs
In Stock

Description

Recombinant Human Coiled-Coil Domain-Containing Protein 56 (CCDC56): Overview

CCDC56 (cytochrome c oxidase assembly factor 3, COA3) is a mitochondrial protein critical for the biogenesis of Complex IV (cytochrome c oxidase, COX) in the electron transport chain. Its recombinant form is widely used in research to study mitochondrial disorders, oxidative phosphorylation (OXPHOS), and COX assembly mechanisms.

Protein Structure

  • Domain: Contains a coiled-coil motif, essential for protein-protein interactions.

  • Sequence: Human CCDC56 (106 amino acids) shares 42% identity with Drosophila melanogaster CCDC56 (87 amino acids) .

  • Localization: Primarily mitochondrial, though cytoplasmic and membrane-associated roles are reported .

Functional Role

  • COX Assembly: Acts as a chaperone for mitochondrial-encoded COX subunits (e.g., MT-CO1) and regulates nuclear-encoded subunit assembly .

  • MITRAC Complex: Part of the mitochondrial translation regulation assembly intermediate of cytochrome c oxidase (MITRAC), which bridges translation and assembly processes .

  • Viability: Essential for development in Drosophila; knockout models show 100% lethality at the third larval instar due to COX dysfunction .

Production Methods and Recombinant Forms

Recombinant CCDC56 is produced in diverse systems, including E. coli, HEK-293 cells, and cell-free expression systems. Key variants and applications are summarized below:

SourceTagPurityApplicationsReferences
E. coliHis, GST, Biotin≥85% (SDS-PAGE)Antibody production, ELISA, Western blot
HEK-293 cellsMyc-DYKDDDDK>80%Native antigen for antibody assays
Cell-free expressionN-terminal His6-ABP≥85%Blocking antigen for competition assays

Functional Studies

  • COX Deficiency Models: Recombinant CCDC56 rescues COX activity in Drosophila knockouts, confirming its role in COX biogenesis .

  • Mitochondrial Translation: Required for efficient translation of MT-CO1 mRNA and proper OXPHOS complex assembly .

Diagnostic and Therapeutic Tools

  • Antibody Production: Biotin-conjugated polyclonal antibodies (e.g., bs-8116R-Biotin) are used for immunohistochemistry and Western blotting .

  • Drug Discovery: Serves as a positive control in studies targeting mitochondrial disorders linked to COX dysfunction .

Functional Insights

  • COX Activity: ccdc56 knockouts in Drosophila show a 50% reduction in COX activity, while other OXPHOS complexes remain unaffected or hyperactive .

  • Rescue Experiments: Reintroducing wild-type CCDC56 restores COX function, confirming its specificity in COX assembly .

Synonyms and Cross-References

  • Aliases: COA3, MITRAC12, HSPC009, COX25 .

  • Species Orthologs: Recombinant CCDC56 is available for human, zebrafish, mouse, bovine, and Drosophila .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COA3; CCDC56; MITRAC12; HSPC009; Cytochrome c oxidase assembly factor 3 homolog, mitochondrial; Coiled-coil domain-containing protein 56; Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-106
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
COA3
Target Protein Sequence
ASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTG LGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS
Uniprot No.

Target Background

Function

CCDC56 is a core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex), regulating cytochrome c oxidase assembly. MITRAC complexes govern both the translation of mitochondrially-encoded components and the assembly of nuclear-encoded components imported into the mitochondrion. CCDC56 is essential for efficient translation of MT-CO1 and the assembly of mitochondrial respiratory chain complex IV.

Gene References Into Functions
  1. Data indicate that CCDC56 is a disordered protein, and its flexibility is critical for interactions with other proteins, facilitating mitochondrial protein translocation and the assembly of respiratory chain proteins. PMID: 27791355
  2. The interdependence of CCDC56 and COX14 in COX assembly is evident from the undetectability of COX14 in CCDC56-deficient fibroblasts and vice versa. PMID: 25604084
  3. CCDC56 co-translationally stabilizes COX1 and promotes its assembly with partner subunits. PMID: 23362268
  4. A comprehensive study identified mammalian cytochrome c oxidase assembly factors, including MITRAC12, which defines the MITRAC complexes. PMID: 23260140
  5. CCDC56 is the human ortholog of the fungal COA3 (cytochrome oxidase assembly) protein. PMID: 22356826
Database Links

HGNC: 24990

OMIM: 614775

KEGG: hsa:28958

STRING: 9606.ENSP00000354762

UniGene: Hs.16059

Protein Families
COA3 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the structural composition of the CCDC56 coiled-coil domain?

The CCDC56 protein, like other coiled-coil domain proteins, features a characteristic heptad repeat pattern (often denoted as "abcdefg") where hydrophobic residues typically occupy positions 'a' and 'd', forming a well-packed interface. Electrostatic complementarity is usually observed between 'e' and 'g' positions on opposing helices . While the specific CCDC56 structure has not been fully resolved, comparative analysis with other coiled-coil domain proteins suggests it likely forms oligomeric assemblies similar to those of TRIM family proteins, where antiparallel dimers can interact to form functional tetramers .

How should researchers optimize expression systems for recombinant CCDC56 production?

For optimal expression of recombinant CCDC56, researchers should consider a strategy similar to that used for other coiled-coil domain proteins. Based on successful approaches with related proteins, the recommended protocol includes:

  • Clone the DNA sequence encoding human CCDC56 into a pET28-based vector system

  • Include a tandem tag (His6-MBP) with an HRV-3C protease cleavage site

  • Transform the construct into BL21(DE3) strain for bacterial expression

  • Culture in LB medium with appropriate antibiotic (e.g., 50 μg/mL kanamycin)

  • Induce expression at OD600 of 0.6-0.8 with IPTG

  • Harvest and purify using affinity chromatography followed by size exclusion chromatography

This approach helps maintain protein solubility and facilitates downstream purification while preserving the structural integrity of the coiled-coil domains.

What purification challenges are commonly encountered with CCDC56, and how can they be addressed?

Purification of coiled-coil domain proteins like CCDC56 presents several challenges due to their oligomerization tendencies. Common issues include:

  • Aggregation during concentration

  • Heterogeneous oligomeric states

  • Non-specific binding during affinity purification

  • Protein instability after tag removal

To address these challenges, researchers should:

  • Use a step-wise purification approach beginning with affinity chromatography (Ni-NTA for His-tagged constructs)

  • Include 5-10% glycerol in all buffers to improve stability

  • Perform size exclusion chromatography to separate different oligomeric states

  • Consider using maltose-binding protein (MBP) as a fusion partner to enhance solubility

  • Optimize buffer conditions with varying salt concentrations (typically 150-300 mM NaCl)

Monitoring protein quality at each purification step using SDS-PAGE and dynamic light scattering is essential for ensuring homogeneity of the final preparation.

How can researchers verify the oligomerization state of purified CCDC56?

To determine the oligomerization state of purified CCDC56, researchers should employ multiple complementary techniques:

  • SEC-MALS (Size Exclusion Chromatography coupled with Multi-Angle Light Scattering): This provides accurate molecular weight determination of proteins in solution. Use a column such as WTC-010S5 with PBS as running buffer, loading 40 μL of protein at 5-10 mg/mL concentration .

  • Chemical Cross-linking: Utilize glutaraldehyde at concentrations of 1-8 mM (final) with a 5-minute reaction time at room temperature, followed by quenching with saturated glycine solution. Analyze cross-linked products by SDS-PAGE to visualize oligomeric states .

  • Analytical Ultracentrifugation: This provides information about both mass and shape of protein complexes in solution.

TechniqueApplicationData OutputAdvantages
SEC-MALSMolar mass determinationAbsolute molecular weightNo calibration needed
Cross-linkingOligomer visualizationLadder of oligomeric statesSimple to perform
Analytical UltracentrifugationSedimentation analysisSedimentation coefficientHigh resolution of species

Combining these approaches provides robust evidence of the native oligomerization state of CCDC56 in solution.

How does the quaternary structure of CCDC56 influence its biological function?

The quaternary structure of coiled-coil domain proteins like CCDC56 is crucial for their biological function. Based on structural studies of related proteins such as TRIM56, it is likely that CCDC56 forms a tetramer through interactions between two antiparallel dimers at small crossing angles . This tetrameric arrangement potentially creates a scaffold that positions functional domains for optimal interaction with binding partners or substrates.

The spatial arrangement conferred by the coiled-coil domain positions N-terminal and C-terminal functional domains at opposite ends of the structure, allowing for:

  • Proper orientation of catalytic domains relative to substrates

  • Creation of binding platforms for protein-protein interactions

  • Regulation of activity through conformational changes

This structural organization is likely essential for CCDC56's biological functions, though specific studies on CCDC56 are needed to confirm the exact relationship between its structure and function .

What mutagenesis approaches are most effective for studying CCDC56 coiled-coil domain interactions?

For effective mutagenesis studies of CCDC56 coiled-coil domains, researchers should:

  • Target key residues in the heptad repeat: Focus on 'a' and 'd' positions that form the hydrophobic core, as well as 'e' and 'g' positions that mediate electrostatic interactions between helices.

  • Use site-directed mutagenesis: Employ protocols similar to those used for other coiled-coil proteins:

    • Design primers with appropriate overlaps

    • Confirm constructs by DNA sequencing before expression

    • Create both single and multiple mutations to identify cooperative effects

  • Consider charge-swap mutations: Replace charged residues with oppositely charged amino acids to test electrostatic contribution to oligomerization.

  • Introduce helix-breaking residues: Strategic placement of proline residues can disrupt helical structure to test structural requirements.

The impact of mutations should be assessed using the oligomerization analysis techniques described in section 1.4, combined with functional assays specific to CCDC56's known activities.

How can researchers distinguish between non-specific aggregation and physiologically relevant oligomerization in CCDC56 preparations?

Distinguishing between non-specific aggregation and physiologically relevant oligomerization of CCDC56 requires systematic characterization:

  • Concentration dependence: Physiological oligomerization often shows clear concentration-dependent transitions between states, while aggregation typically increases continuously with concentration.

  • Temperature and pH effects: Analyze protein behavior across physiologically relevant conditions:

    • Test oligomerization at 4°C, 25°C, and 37°C

    • Assess stability across pH range 6.5-8.0

    • Compare results to assess if transitions are reversible (indicative of physiological oligomerization)

  • Cross-linking time course: Perform glutaraldehyde cross-linking with varying reaction times (30 seconds to 10 minutes) to capture intermediate states .

  • Negative stain electron microscopy: This provides direct visualization of protein complexes versus amorphous aggregates.

The table below summarizes key differences between physiological oligomerization and non-specific aggregation:

ParameterPhysiological OligomerizationNon-specific Aggregation
Size distributionDiscrete populationsContinuous, heterogeneous
Concentration dependenceDefined transitionsContinuous increase
Temperature sensitivityReversible changesOften irreversible
Cross-linking patternDistinct bandsSmears or high MW material
Biological activityMaintained or enhancedTypically lost

What computational approaches can predict CCDC56 interaction networks based on coiled-coil domain analysis?

Advanced computational methods can help predict CCDC56 interaction networks:

  • Coiled-coil prediction algorithms: Tools like COILS, Paircoil2, and MARCOIL can identify potential interaction interfaces in CCDC56 and potential binding partners.

  • Molecular dynamics simulations: These can model the stability of predicted CCDC56 oligomers and potential heteromeric interactions with other coiled-coil proteins.

  • Protein-protein interaction databases: Integration with databases like STRING and BioGRID can identify experimentally validated interactions involving proteins with similar domain architecture.

  • Sequence-based interaction prediction: Machine learning approaches trained on known coiled-coil interactions can identify potential partners based on complementarity patterns in the heptad repeats .

Researchers should validate computational predictions using experimental approaches such as yeast two-hybrid screens or co-immunoprecipitation studies, similar to those used for other coiled-coil domain proteins like SYNZIPs .

How should researchers design experimental controls when studying CCDC56 oligomerization?

Proper experimental controls are critical for studies of CCDC56 oligomerization:

  • Positive oligomerization controls: Include well-characterized coiled-coil proteins with known oligomerization properties, such as GCN4 leucine zipper (dimer) or SYNZIP14/16 (known to form dimers) .

  • Negative controls: Express and purify a non-coiled-coil domain protein under identical conditions to distinguish between sequence-specific and non-specific effects.

  • Concentration controls: Analyze protein behavior across a wide concentration range (0.1-10 mg/mL) to identify concentration-dependent effects.

  • Buffer composition controls: Test multiple buffer conditions to ensure observations are not artifacts of specific buffer components:

    • Vary salt concentration (100-500 mM)

    • Test with and without reducing agents

    • Include different stabilizing agents (glycerol, arginine, trehalose)

  • Mutant controls: Generate and characterize a series of mutants with predicted disruptions to coiled-coil interactions, such as substitutions at critical 'a' and 'd' positions .

The table below provides a framework for control experiments in CCDC56 oligomerization studies:

Control TypePurposeImplementation
Positive controlValidate assay functionalityInclude known oligomeric coiled-coil protein
Negative controlEstablish baselineInclude non-coiled-coil protein
Concentration seriesDetermine concentration dependenceTest 5+ concentrations
Buffer variationRule out buffer artifactsTest 3+ buffer compositions
Mutation controlsConfirm sequence specificityTest 3+ targeted mutations

What cross-linking methodologies are most suitable for capturing transient CCDC56 interactions?

For capturing transient CCDC56 interactions, researchers should consider multiple cross-linking approaches:

  • Chemical cross-linkers with varying spacer lengths:

    • Glutaraldehyde (direct cross-linking of nearby amines)

    • BS3/DSS (8.6 Å spacer arm)

    • EGS (16.1 Å spacer arm)

    • Use a concentration series (1-8 mM) with controlled reaction times (1-10 minutes)

  • Photo-activatable cross-linkers:

    • Incorporate photo-leucine or photo-methionine during expression

    • Use UV irradiation to activate cross-linking at specific timepoints

    • Ideal for capturing truly transient interactions

  • Cross-linking combined with mass spectrometry (XL-MS):

    • Apply isotopically labeled cross-linkers to improve detection

    • Digest cross-linked samples with multiple proteases

    • Analyze by LC-MS/MS to identify specific residues involved in interactions

  • In vivo cross-linking:

    • Apply membrane-permeable cross-linkers to cultured cells

    • Immunoprecipitate CCDC56 complexes after cross-linking

    • Identify physiologically relevant interaction partners

Each method offers different advantages for capturing interactions with varying stability and proximity requirements.

How can researchers quantitatively compare CCDC56 oligomerization dynamics under different conditions?

For quantitative comparison of CCDC56 oligomerization dynamics, researchers should employ:

  • Fluorescence anisotropy:

    • Label CCDC56 with fluorescent probes

    • Monitor changes in anisotropy as a function of concentration

    • Fit data to appropriate binding models to extract association constants

    • Compare Kd values across different experimental conditions

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of oligomerization

    • Determine enthalpy (ΔH), entropy (ΔS), and free energy (ΔG)

    • Compare binding constants at different temperatures and pH values

  • Surface Plasmon Resonance (SPR):

    • Immobilize CCDC56 on sensor chips

    • Monitor real-time association and dissociation

    • Calculate kon and koff rates under varying conditions

    • Compare equilibrium dissociation constants (KD)

  • Bio-Layer Interferometry (BLI):

    • Similar to SPR but with different detection principle

    • Suitable for high-throughput analysis of multiple conditions

The following data presentation format effectively communicates oligomerization parameters:

ConditionMethodAssociation Constant (Ka)Dissociation Constant (Kd)ΔH (kcal/mol)ΔS (cal/mol·K)ΔG (kcal/mol)
pH 7.4, 150 mM NaClITC[value][value][value][value][value]
pH 7.4, 300 mM NaClITC[value][value][value][value][value]
pH 6.5, 150 mM NaClITC[value][value][value][value][value]

How should researchers interpret conflicting oligomerization data from different analytical techniques?

When faced with conflicting oligomerization data for CCDC56 from different techniques, researchers should:

  • Consider technique-specific biases:

    • SEC-MALS may be affected by protein-column interactions

    • Cross-linking can stabilize transient interactions

    • Native PAGE mobility is influenced by both size and charge

  • Evaluate concentration effects:

    • Different techniques operate at different concentration ranges

    • Construct concentration-oligomerization state diagrams across techniques

    • Identify technique-specific concentration thresholds

  • Assess buffer and environmental influences:

    • Systematically test identical buffer conditions across techniques

    • Document temperature, pH, and ionic strength across experiments

    • Create a condition-outcome matrix to identify consistent patterns

  • Use orthogonal approaches in combination:

    • Techniques that measure different physical properties should be prioritized

    • Weight evidence from techniques with higher resolution more heavily

    • Consider developing CCDC56-specific biophysical models that integrate multiple data types

  • Biological validation:

    • Test functional consequences of oligomerization in cellular assays

    • Determine which oligomeric state correlates with biological activity

    • Verify native oligomerization state in cell lysates under physiological conditions

What statistical approaches are most appropriate for analyzing CCDC56 structural variation across experiments?

For analyzing structural variation in CCDC56 experiments, researchers should apply:

For reporting results, include statistical measures of reliability:

ParameterMean Value95% Confidence IntervalCoefficient of VariationSample Size
Dimer KD[value][value][value][value]
Tetramer KD[value][value][value][value]
α-helical content[value][value][value][value]
Thermal stability[value][value][value][value]

How can researchers integrate structural data with functional assays to establish structure-function relationships for CCDC56?

To establish CCDC56 structure-function relationships, researchers should:

  • Design a systematic mutagenesis panel:

    • Target residues throughout the coiled-coil domain

    • Include mutations at 'a', 'd', 'e', and 'g' positions of the heptad repeat

    • Create both subtle (conservative) and disruptive mutations

  • Perform parallel structural and functional analyses:

    • Characterize each mutant's oligomerization state using SEC-MALS

    • Measure α-helical content by circular dichroism spectroscopy

    • Determine thermal stability using differential scanning fluorimetry

    • Assess biological activity in relevant functional assays

  • Develop quantitative correlations:

    • Plot functional activity against structural parameters

    • Calculate correlation coefficients between structure and function

    • Perform multiple regression analysis to identify which structural features best predict function

  • Employ structural modeling:

    • Generate homology models based on related coiled-coil structures

    • Dock models with potential interaction partners

    • Validate models with experimental constraints from cross-linking or mutagenesis

  • Consider dynamic structural changes:

    • Use hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Correlate regional flexibility with functional outcomes

    • Identify allosteric mechanisms that couple structural changes to functional effects

This integrated approach helps establish causal relationships between specific structural features and biological functions, moving beyond correlative observations.

How can structural insights into CCDC56 inform the design of protein interaction modulators?

Structural knowledge of CCDC56 can guide the development of interaction modulators through:

  • Rational peptide design:

    • Create peptides matching specific regions of the coiled-coil domain

    • Incorporate non-natural amino acids to enhance stability or binding affinity

    • Design stapled peptides that lock the helical conformation for improved binding

  • Small molecule targeting:

    • Identify pockets or interfaces in the coiled-coil structure

    • Perform virtual screening against these sites

    • Develop compounds that stabilize or disrupt specific oligomeric states

  • Engineered protein domains:

    • Design alternative coiled-coil domains with enhanced specificity

    • Create dominant-negative versions that bind but inhibit function

    • Develop biosensors based on coiled-coil interactions for detecting CCDC56 activity

  • Structure-guided antibody development:

    • Target conformation-specific epitopes

    • Develop antibodies that recognize specific oligomeric states

    • Create intrabodies for cellular applications

The most promising approaches will likely combine computational design with experimental validation using the biophysical techniques discussed in previous sections .

What are the current methodological limitations in studying CCDC56, and how might they be overcome in the future?

Current methodological limitations in CCDC56 research include:

  • Protein production challenges:

    • Difficulty expressing full-length protein

    • Heterogeneity in recombinant preparations

    Future solutions: Explore cell-free expression systems, nanobody-assisted purification, and improved fusion tags for enhanced solubility and homogeneity.

  • Structural analysis limitations:

    • Challenges in crystallizing dynamic coiled-coil assemblies

    • Limited resolution in solution-based structural methods

    Future solutions: Apply advances in cryo-electron microscopy for medium-sized complexes, develop integrated structural biology approaches combining multiple techniques, and explore new computational methods for modeling dynamic assemblies.

  • Functional assay limitations:

    • Incomplete understanding of biological roles

    • Lack of high-throughput functional screens

    Future solutions: Develop CRISPR-based functional genomics approaches, utilize proteomic profiling to identify interactors, and establish organoid systems for physiological functional assessment.

  • Specificity determination:

    • Difficulty distinguishing specific from non-specific interactions

    • Challenges in predicting interaction specificity

    Future solutions: Develop machine learning approaches trained on larger datasets of coiled-coil interactions, apply high-throughput mutagenesis with deep sequencing readouts, and utilize proximity labeling in cellular contexts .

Addressing these limitations will require interdisciplinary approaches combining advances in structural biology, computational modeling, and functional genomics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.