Recombinant Human Leucine-rich single-pass membrane protein 1 (Lsmem1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LSMEM1; C7orf53; Leucine-rich single-pass membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LSMEM1
Target Protein Sequence
MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSR SLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRL NQLNQLDSEQN
Uniprot No.

Target Background

Database Links

HGNC: 22036

KEGG: hsa:286006

UniGene: Hs.396189

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is LSMEM1 and where is it encoded in the human genome?

LSMEM1 (Leucine-Rich Single-Pass Membrane Protein 1) is an integral membrane protein encoded by the LSMEM1 gene (also known as C7orf53) located on chromosome 7q31.1 in humans. The gene neighbors IFRD1 and contains 5 exons. The human mRNA is 1686 base pairs long with a 5' UTR spanning positions 1-341 and a 3' UTR from positions 738-1686 .

What are the key physical and chemical properties of the LSMEM1 protein?

LSMEM1 is characterized by the following properties:

PropertyValue
Amino acid length131 aa
Molecular weight14.2-14.5 kDa
Isoelectric point~5 (slightly acidic)
Membrane topologySingle transmembrane segment
Secondary structurePrimarily coils with few beta strands
Post-translational modificationsGlycation and phosphorylation
Signal peptideNot predicted

As its name suggests, LSMEM1 is a single-pass membrane protein with a transmembrane domain that anchors it to cellular membranes .

How evolutionarily conserved is LSMEM1 across species?

LSMEM1 demonstrates interesting evolutionary conservation patterns:

  • No known paralogs exist in humans

  • Orthologous proteins primarily found in mammals, birds, and reptiles

  • More distant orthologs present in amphibians and sarcopterygii (lobe-finned fish)

  • Notably absent in invertebrates, fungi, and prokaryotes

  • Contains conserved domain of unknown function DUF4577

  • Shows slow evolutionary rate when compared to rapidly evolving proteins like fibrinopeptides, similar to conserved proteins like cytochrome c

What is the tissue expression pattern of LSMEM1 in humans?

LSMEM1 shows distinctive tissue-specific expression patterns:

Tissue TypeExpression Level
Skeletal muscleVery high
Nerve tissueHigh
Uterus, testis, bone marrow, heart, intestinesModerate
Brain, pancreasLow

The protein is expressed in both fetal and adult developmental stages, suggesting potential roles throughout the human lifespan .

What methodologies are recommended for detecting endogenous LSMEM1 in tissue samples?

For researchers investigating endogenous LSMEM1 expression:

  • Immunohistochemistry (IHC): Use validated antibodies against LSMEM1 with appropriate controls. When selecting antibodies, prioritize those raised against human LSMEM1 epitopes that are not within the transmembrane domain.

  • Western blotting: For protein lysates, use membrane protein extraction protocols that effectively solubilize single-pass membrane proteins. Standard protocols would include:

    • Tissue homogenization in buffer containing 1% NP-40 or Triton X-100

    • Addition of protease inhibitors to prevent degradation

    • Membrane fraction isolation via ultracentrifugation

    • Separation on SDS-PAGE with expected band at 14-15 kDa

  • RT-qPCR: For mRNA detection, design primers spanning exon-exon junctions to avoid genomic DNA contamination. The 5 exons of LSMEM1 provide multiple options for primer design.

  • RNA-Seq: When analyzing transcriptomic data, consider the moderate expression levels in most tissues and very high expression in skeletal muscle when normalizing and interpreting results.

Which expression systems are most suitable for producing recombinant human LSMEM1?

The choice of expression system depends on research objectives:

Expression SystemAdvantagesLimitationsRecommended For
E. coliCost-effective, high yieldPotential improper folding, lack of PTMsStructural studies of domains, antibody production
Insect cellsBetter folding than bacterial systems, some PTMsModerate cost, glycosylation differs from mammalianFunctional studies requiring proper folding
Mammalian cells (HEK293, CHO)Native-like folding and PTMsHigher cost, lower yieldInteraction studies, functional assays
Cell-free systemsRapid production, flexibility with detergentsLimited PTMs, higher costRapid screening, difficult-to-express constructs

For LSMEM1, mammalian expression systems would likely provide the most physiologically relevant protein, particularly if post-translational modifications like glycation and phosphorylation are important for function.

What purification strategies are effective for recombinant single-pass membrane proteins like LSMEM1?

Purification of LSMEM1 would typically follow this methodological workflow:

  • Membrane extraction: Use gentle detergents (DDM, LMNG, or Triton X-100) to solubilize the membrane fraction without denaturing the protein.

  • Size exclusion chromatography: Remove aggregates and isolate properly folded monomeric protein in appropriate detergent micelles.

  • Quality control: Verify protein purity by SDS-PAGE (>95%) and identity by western blotting and mass spectrometry.

  • Functional validation: Develop binding or activity assays based on predicted protein functions.

How can researchers assess the proper folding and functionality of recombinant LSMEM1?

To validate recombinant LSMEM1:

  • Circular dichroism (CD) spectroscopy: Confirm secondary structure composition (predominantly coils with few beta strands).

  • Thermal shift assays: Assess protein stability in various buffer conditions.

  • Dynamic light scattering (DLS): Ensure homogeneity and proper incorporation into detergent micelles or nanodiscs.

  • Binding assays: Develop pull-down or surface plasmon resonance (SPR) experiments with predicted interaction partners.

  • Native PAGE: Evaluate oligomeric state and homogeneity.

For membrane proteins like LSMEM1, proper folding is critical and should be assessed before proceeding to functional studies.

What cellular localization methods are recommended for studying LSMEM1 distribution?

To investigate LSMEM1 cellular localization:

  • Fluorescence microscopy: Express LSMEM1 with fluorescent protein tags (GFP, mCherry) and co-stain with organelle markers.

  • Immunofluorescence: Use specific antibodies against LSMEM1 with membrane and organelle markers.

  • Subcellular fractionation: Isolate membrane fractions followed by western blotting.

  • Proximity labeling: BioID or APEX2 fusions to identify proximal proteins in the cellular context.

  • Electron microscopy: Immunogold labeling for high-resolution localization.

Given LSMEM1's single transmembrane domain, researchers should investigate whether it localizes to the plasma membrane or internal membranes, and whether this varies by tissue type.

How can CRISPR/Cas9 technology be applied to study LSMEM1 function?

CRISPR/Cas9 approaches for LSMEM1 functional studies:

  • Knockout studies: Design guide RNAs targeting early exons (exons 1-2) to create frameshift mutations. Given LSMEM1's high expression in skeletal muscle, phenotypic analysis should focus on muscle function.

  • Knock-in studies: Insert reporter genes (GFP, luciferase) to track endogenous expression.

  • Domain mutagenesis: Create specific mutations to identify functional residues without disrupting the entire protein.

  • Conditional knockouts: Use tissue-specific Cre-loxP systems to study tissue-specific functions, particularly in skeletal muscle and nerve tissue where expression is highest.

  • CRISPRi/CRISPRa: For temporally controlled knockdown or overexpression studies.

What approaches are recommended for identifying LSMEM1 interaction partners?

To identify proteins that interact with LSMEM1:

  • Yeast two-hybrid assays: Using either full-length protein or specific domains (excluding the transmembrane domain).

  • Co-immunoprecipitation: Express tagged LSMEM1 in relevant cell types, followed by pull-down and mass spectrometry.

  • Proximity labeling: BioID or APEX2 fusions to identify proteins in close proximity in living cells.

  • Cross-linking mass spectrometry: To capture transient or weak interactions.

  • Membrane protein-specific techniques: Split-ubiquitin yeast two-hybrid systems designed for membrane proteins.

When analyzing potential interaction partners, focus on proteins expressed in the same tissues where LSMEM1 shows high expression, particularly skeletal muscle and nerve tissue.

How might researchers address the challenges of studying proteins with unknown function like LSMEM1?

For proteins of unknown function, a multi-faceted approach is recommended:

  • Domain analysis: The DUF4577 domain in LSMEM1 should be characterized through structural studies and comparison with other proteins containing similar domains.

  • Evolutionary analysis: Compare expression and function across species to identify conserved roles.

  • Transcriptomic correlation: Identify genes co-expressed with LSMEM1 across tissues to suggest functional pathways.

  • Phenotypic screening: Generate knockout models and perform comprehensive phenotyping, focusing on tissues with high expression.

  • Interactome mapping: Identify binding partners to place LSMEM1 in biological pathways.

  • PTM analysis: Characterize the functional significance of predicted glycation and phosphorylation sites.

What are the considerations for developing antibodies against LSMEM1?

Developing effective antibodies against membrane proteins requires careful planning:

  • Epitope selection: Choose antigenic regions outside the transmembrane domain, preferably in exposed extracellular or cytoplasmic domains.

  • Peptide design: For peptide immunization, select sequences with high antigenicity scores and minimal homology to other proteins.

  • Recombinant antigen: Use purified domains or full-length protein in detergent micelles or nanodiscs.

  • Validation strategy: Test antibodies in multiple assays (western blot, IHC, IP) using both recombinant protein and endogenous LSMEM1 from skeletal muscle.

  • Controls: Include LSMEM1 knockout tissues/cells as negative controls to confirm specificity.

How can researchers investigate the potential role of LSMEM1 in disease contexts?

To explore disease relevance:

  • Genetic association studies: Analyze GWAS data for associations between LSMEM1 variants and diseases, particularly those affecting tissues with high LSMEM1 expression.

  • Expression analysis: Compare LSMEM1 levels in healthy versus diseased tissues, with focus on skeletal muscle disorders.

  • Functional studies in disease models: Examine how LSMEM1 knockout or overexpression affects disease progression in relevant models.

  • Patient sample analysis: Screen for mutations or expression changes in patient cohorts with relevant conditions.

  • Therapeutic potential: Assess whether modulating LSMEM1 function could have therapeutic applications based on its biological role.

Given its high expression in skeletal muscle, investigations into muscular disorders would be a logical starting point for disease-related research.

How can researchers overcome common challenges in membrane protein expression and purification?

When encountering difficulties with LSMEM1 expression and purification:

  • Low expression yields:

    • Try different promoters (CMV, EF1α for mammalian cells)

    • Optimize codon usage for the expression system

    • Use specialized cell lines designed for membrane protein expression

    • Test expression at lower temperatures (30°C instead of 37°C)

  • Protein aggregation:

    • Screen multiple detergents (DDM, LMNG, GDN)

    • Try amphipols or nanodiscs for stabilization

    • Add stabilizing agents like glycerol or specific lipids

    • Consider fusion partners that enhance solubility (MBP, SUMO)

  • Purification issues:

    • Test various tag positions (N-terminal vs. C-terminal)

    • Implement multi-step purification strategies

    • Use mild solubilization conditions to preserve native structure

  • Verification challenges:

    • Develop specific activity assays based on predicted functions

    • Use multiple biophysical techniques to confirm proper folding

What strategies can address contradictory findings in LSMEM1 functional studies?

When faced with conflicting results:

  • Methodological validation:

    • Verify antibody specificity using knockout controls

    • Confirm protein expression levels in different model systems

    • Validate knockdown/knockout efficiency

  • Context-dependent function:

    • Examine cell type-specific effects

    • Investigate developmental stage differences

    • Consider physiological state variations

  • Technical reconciliation:

    • Compare experimental conditions between studies

    • Assess differences in protein constructs used

    • Consider the impact of tags on protein function

  • Systematic replication:

    • Reproduce key findings using multiple techniques

    • Collaborate with other labs to independently verify results

    • Perform meta-analysis of available data

How should researchers approach the analysis of post-translational modifications of LSMEM1?

For comprehensive PTM analysis:

  • Identification strategy:

    • Use high-resolution mass spectrometry (MS/MS)

    • Enrich for phosphopeptides using TiO₂ or IMAC

    • Apply glycan-specific enrichment methods

  • Site-directed mutagenesis:

    • Create alanine mutants at predicted modification sites

    • Generate phosphomimetic mutants (S/T to D/E)

  • Functional correlation:

    • Compare modification patterns across tissues

    • Examine changes in modification during differentiation or activation

    • Correlate modifications with protein localization or interactions

  • Biological significance:

    • Identify enzymes responsible for modifications

    • Determine how modifications affect protein stability

    • Assess impact on protein-protein interactions

What emerging technologies could advance our understanding of LSMEM1?

Several cutting-edge approaches could accelerate LSMEM1 research:

  • Cryo-EM for structural studies: Determine high-resolution structure of full-length LSMEM1 in a lipid environment.

  • Single-cell transcriptomics: Map expression patterns at cellular resolution in tissues with high LSMEM1 expression.

  • Spatially resolved proteomics: Visualize LSMEM1 distribution within tissues and subcellular compartments.

  • AlphaFold2/RoseTTAFold: Generate structural predictions to guide functional studies and drug design.

  • Organoid models: Study LSMEM1 function in 3D tissue-like environments derived from stem cells.

  • CRISPR screens: Identify genetic interactions through genome-wide knockout screens in LSMEM1-expressing cells.

  • Protein engineering: Create biosensors based on LSMEM1 to monitor binding events or conformational changes.

How might computational approaches contribute to LSMEM1 research?

Computational methods offer powerful tools for studying LSMEM1:

  • Network analysis: Place LSMEM1 in protein-protein interaction networks based on co-expression data.

  • Molecular dynamics simulations: Model LSMEM1 behavior in membranes to understand conformational dynamics.

  • Machine learning: Predict potential functions based on sequence patterns and structural features.

  • Evolutionary analysis: Trace the emergence and diversification of LSMEM1 across species.

  • Integrative multi-omics: Combine transcriptomic, proteomic, and metabolomic data to infer LSMEM1 function.

  • Virtual screening: Identify small molecules that may bind to LSMEM1 for use as research tools.

What collaborative research approaches would be most beneficial for advancing LSMEM1 research?

Progress in understanding LSMEM1 would benefit from:

  • Multi-disciplinary teams: Combining expertise in structural biology, cell biology, physiology, and computational biology.

  • Tissue-specific collaborations: Partnering with specialists in skeletal muscle and nerve tissue research where LSMEM1 is highly expressed.

  • Technology sharing: Establishing repositories for LSMEM1 research tools (plasmids, antibodies, cell lines).

  • Data integration: Creating centralized databases for LSMEM1-related findings across species and experimental systems.

  • Clinical partnerships: Collaborating with clinicians to identify potential disease associations, particularly in neuromuscular disorders.

  • Industry-academic partnerships: Developing tools and resources that could benefit both basic research and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.