Recombinant Human Collagen alpha-3 (VI) chain (COL6A3), partial

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Collagen alpha-3 (VI) chain (COL6A3), partial

Recombinant Human Collagen alpha-3 (VI) chain (COL6A3), partial, is a truncated form of the alpha-3 subunit of type VI collagen, a microfibrillar extracellular matrix (ECM) protein critical for tissue integrity and cell adhesion. This recombinant protein is synthesized using in vitro expression systems (e.g., E. coli or HEK293 cells) and is typically tagged for purification (e.g., N-terminal 6xHis-B2M or His tag). The "partial" designation refers to its truncated structure, often spanning specific amino acid regions (e.g., 2853–3176aa or 3101–3177aa) rather than the full-length sequence .

Role in Collagen VI Assembly

The alpha-3 chain is essential for the proper assembly of collagen VI microfibrils. It interacts with alpha-1 and alpha-2 chains to form triple-helical monomers, which dimerize and tetramerize to create beaded microfibrils. The C-terminal domains of COL6A3 (e.g., C1 vWF-A modules) are critical for chain selection and helix stabilization .

Disease Associations

  • Ullrich Congenital Muscular Dystrophy (UCMD):

    • Autosomal recessive mutations (e.g., splice-site or nonsense mutations) disrupt collagen VI assembly, leading to severe muscle weakness and contractures. Patients with partial COL6A3 deficiency may exhibit milder phenotypes due to alternative splicing .

  • Bethlem Myopathy:

    • Autosomal dominant mutations in COL6A3 cause early-onset proximal myopathy and joint contractures .

  • Cancer:

    • The C5 domain of COL6A3 (endotrophin) promotes tumor progression via TGF-β signaling, epithelial–mesenchymal transition, and recruitment of stromal cells .

Applications in Research

ApplicationPurposeSources
SDS-PAGEAssessment of protein purity and molecular weight
Western BlotDetection of COL6A3 in lysates or tissue samples
ELISAQuantification of COL6A3 levels in biological fluids
ImmunoprecipitationStudy of protein interactions (e.g., with ECM components)

Clinical and Diagnostic Relevance

  • Biomarkers:

    • Elevated endotrophin (C5 domain) levels correlate with cancer progression and fibrosis .

    • COL6A3 mutations are diagnostic for UCMD and Bethlem myopathy .

  • Therapeutic Potential:

    • Inhibiting endotrophin may reduce tumor angiogenesis and inflammation .

    • Gene therapy or protein replacement strategies are under investigation for collagen VI-related muscular dystrophies .

Comparative Analysis of Recombinant COL6A3 Preparations

SupplierTagExpression SystemRegionPurityPrice (Example)
BiorbytN-terminal 6xHis-B2ME. coli2853–3176aa>85%$705 (0.01 mg)
AbcamHisHEK2933101–3177aa>95%N/A
BiomolN-terminal 6xHis-B2ME. coli2853–3176aa>85%€799 (20 µg)

Note: Prices vary by quantity and supplier.

Product Specs

Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5-50% glycerol.
Note: Glycerol concentration can be customized upon request; please specify your requirements when ordering.
Form
Delivery format: Liquid or Lyophilized powder
Note: While we prioritize shipping the available format, specific format requests will be accommodated. Please indicate your preference during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-B2M tag
Synonyms
CO6A3_HUMAN; COL6A3; Collagen alpha-3(VI) chain; Collagen type VI alpha 3; Collagen VI alpha 3
Datasheet & Coa
Please contact us to get it.
Expression Region
2853-3176aa
Mol. Weight
48.5 kDa
Protein Length
Partial
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Collagen VI functions as a cell adhesion protein.
Gene References Into Functions

Collagen VI Alpha 3 Chain (COL6A3) Functional Roles:

  1. Influences bladder cancer cell viability and angiogenesis; may be involved in TGF-beta/Smad-induced epithelial-mesenchymal transition (EMT). PMID: 30066698
  2. In dermatofibrosarcoma protuberans, the COL6A3-PDGFD fusion is rare and shows a potential association with breast involvement. PMID: 30014607
  3. Downregulated COL6A3 expression correlates with poor prognosis in colorectal cancer (CRC). In silico and knockout studies highlight its clinical relevance in CRC development. PMID: 29620224
  4. COL6A mutations are implicated in Congenital Muscular Dystrophy, manifesting as muscle weakness and respiratory dysfunction. PMID: 29465610
  5. Compound heterozygous mutations in COL6A3 cause myopathy, spanning the Ullrich congenital muscular dystrophy and Bethlem myopathy spectrum. PMID: 29894794
  6. COL6A3-associated dystonia is a newly recognized autosomal-recessive disorder characterized by early onset and variable symptom distribution. PMID: 26687111
  7. Endotrophin overexpression induces fibrosis in white adipose tissue (WAT) adipocytes, inflammation in WAT macrophages, and upregulation of profibrotic and proinflammatory genes in the WAT stromal vascular fraction. PMID: 27729337
  8. Elevated serum endotrophin (COL6A3 cleavage product) is associated with progression to end-stage renal disease (ESRD) in chronic kidney disease (CKD) patients. PMID: 28403201
  9. The causal role of COL6A3 variants in isolated dystonia is questioned due to the high frequency of homozygous carriers in public databases. PMID: 26872670
  10. Circulating plasma COL6A3 is significantly upregulated in colorectal cancer (CRC) patients compared to healthy individuals. PMID: 26338966
  11. COL6A mutations were identified in eight cases presenting with Ullrich congenital muscular dystrophy (UCMD) or Bethlem myopathy (BM). PMID: 25635128
  12. Recessive mutations in COL6A3 cause early-onset isolated dystonia. PMID: 26004199
  13. Increased adipocyte COL6A3 expression is associated with insulin resistance; COL6A3 mRNA correlates with smaller adipocyte size. PMID: 24719315
  14. The heterozygous c.3353A>C mutation in COL6A3 exon 8 is associated with autosomal dominant Bethlem myopathy. PMID: 25449070
  15. COL6A3 expression is downregulated in obesity, while weight loss (diet or surgery) increases its expression. PMID: 25337653
  16. One COL6A3 mutation was identified in Chinese UCMD patients. PMID: 24801232
  17. Elevated endotrophin (COL6alpha3) levels are observed in diabetic patients. PMID: 24647224
  18. Post-translational processing of type VI collagen in articular cartilage: the alpha3(VI) collagen C5 domain is initially incorporated into fibrils but is cleaved after secretion. PMID: 11785962
  19. COL6A3 mutations cause both severe and mild phenotypes of Ullrich congenital muscular dystrophy. PMID: 11992252
  20. The alpha3(VI) C5 domain (Kunitz-type domain) structure has been refined at 0.9 Å resolution. PMID: 12077460
  21. Different alpha3(VI) chain isoforms, including domains of the N10-N7 region, are necessary for proper collagen VI network assembly in the extracellular matrix. PMID: 15965965
  22. The alpha3(VI) C5 domain is present in the extracellular matrix of SaOS-2 N6-C5 expressing cells and fibroblasts; C-terminal processing is not essential for microfibril formation. PMID: 16613849
  23. COL6A3 fusion with colony-stimulating factor-1 is linked to tenosynovial giant cell tumors. PMID: 17918257
  24. Increased COL6A3 mRNA is associated with adipose tissue macrophage chemotaxis, inflammation, and weight gain. PMID: 19837927
Database Links

HGNC: 2213

OMIM: 120250

KEGG: hsa:1293

STRING: 9606.ENSP00000295550

UniGene: Hs.233240

Involvement In Disease
Bethlem myopathy 1 (BTHLM1); Ullrich congenital muscular dystrophy 1 (UCMD1); Dystonia 27 (DYT27)
Protein Families
Type VI collagen family
Subcellular Location
Secreted, extracellular space, extracellular matrix.

Q&A

What is the normal function of COL6A3 in human tissues?

COL6A3 gene provides instructions for making the alpha(α)3(VI) chain, which is one component of type VI collagen. Type VI collagen is a flexible protein found in the extracellular matrix, the space that surrounds cells. The α3(VI) chain combines with other chains to form complete type VI collagen molecules, which play crucial roles in providing structural support to tissues .

How is recombinant COL6A3 typically expressed and purified for research purposes?

Recombinant COL6A3 production typically involves expression in mammalian cell lines such as HEK293 or CHO cells, which provide the post-translational modifications necessary for proper folding and function. For purification, researchers commonly employ:

  • Histidine-tag fusion proteins with metal affinity chromatography

  • Size exclusion chromatography to separate complete molecules

  • Ion-exchange chromatography for further purification

The protein is generally stored in specialized buffers containing stabilizers to prevent degradation. Based on similar collagen protocols, recommended storage conditions include sodium acetate buffer systems with NaCl at appropriate concentrations . For long-term storage, maintaining the protein at -80°C and avoiding repeated freeze-thaw cycles is critical to preserve structural integrity and functionality.

What are the most common detection methods for analyzing recombinant COL6A3 in experimental systems?

The most effective methods for detecting and analyzing recombinant COL6A3 include:

  • Western blotting with domain-specific antibodies

  • ELISA assays for quantification

  • Immunofluorescence for localization studies

  • Mass spectrometry for detailed structural analysis

When analyzing COL6A3, it's important to consider which domain is being targeted. As shown in proteomic studies, different assays target different regions of the protein. For example, SomaScan v4 assay uses two distinct aptamers: one targeting the C-terminal (Kunitz domain, amino acids 3108-3165) and another targeting the N-terminal region (amino acids 26-1036) . The Olink Explore 3072 assay uses a polyclonal antibody targeting the C-terminal Kunitz domain . This domain specificity is crucial for accurate interpretation of experimental results, particularly when studying the bioactive endotrophin fragment.

What experimental controls should be included when working with recombinant COL6A3?

Proper experimental design when working with recombinant COL6A3 should include:

  • Negative controls: Buffer-only samples and non-transfected cell lysates

  • Positive controls: Commercially validated recombinant COL6A3 standards

  • Domain-specific controls: When studying specific domains (N-terminal vs C-terminal), include controls that distinguish between these regions

  • Proteolytic processing controls: Include samples with and without proteolytic processing to distinguish full-length protein from cleaved fragments

When analyzing cleavage products like endotrophin, researchers should include parallel samples with protease inhibitors to confirm specificity of processing events. Based on protocols for similar collagens, consider including appropriate enzyme controls (such as BMP-1) when studying proteolytic processing .

How do mutations in COL6A3 affect protein structure and function in collagen VI-related dystrophies?

Mutations in COL6A3 impact type VI collagen through multiple mechanisms, creating a spectrum of effects that correlate with clinical severity. The most frequent mutations affect glycine residues, which are critical for proper triple helix formation . These mutations disrupt the structure and function of COL6A3 through several mechanisms:

  • Altered chain incorporation: Some mutations produce α3(VI) chains that can be incorporated into collagen VI molecules but compromise structural integrity

  • Failed chain incorporation: Other mutations produce chains that cannot be incorporated at all

  • Complete absence: Some mutations prevent production of any functional α3(VI) chain

The severity of collagen VI-related dystrophy generally correlates with the amount of functional type VI collagen, with lower amounts leading to more severe phenotypes with earlier onset. These structural changes ultimately lead to an unstable extracellular matrix that progressively loses attachment to cells through the basement membrane, resulting in declining muscle cell and connective tissue stability .

What is the relationship between COL6A3-derived endotrophin and coronary artery disease in the context of obesity?

Recent Mendelian randomization studies have identified COL6A3 as a key mediator in the relationship between obesity and coronary artery disease (CAD). Through multifaceted analysis:

  • Causal relationship: Each standard deviation increase in COL6A3 levels is associated with significantly increased odds of CAD (OR = 1.47, 95% CI: 1.26–1.70, P = 4.7 × 10^-7)

  • Domain-specific effects: When analyzing specific domains, only the C-terminal (Kunitz) domain showed significant association with CAD (OR = 1.46, 95% CI: 1.37–1.93, P = 2.7 × 10^-8), while the N-terminal domain showed no significant association (OR = 1.06, 95% CI: 0.96–1.18, P = 0.22)

  • Replication across cohorts: This association has been replicated across multiple independent cohorts using different proteomic platforms:

    • UK Biobank (OR = 1.30, 95% CI: 1.17–1.45)

    • Fenland (OR = 1.23, 95%CI: 1.12–1.35)

    • ARIC (OR = 1.09, 95%CI: 1.05–1.13)

The C-terminal domain is proteolytically cleaved to form endotrophin, a bioactive fragment that induces fibrosis and inflammation, contributing to obesity-induced metabolic dysfunction . This finding suggests that endotrophin specifically mediates the pathological effects of COL6A3 on CAD development.

What specific cell types express COL6A3 at the highest levels and how does this expression pattern change in disease states?

Single-cell RNA sequencing analysis has revealed cell type-specific expression patterns of COL6A3 in both adipose tissue and coronary arteries. Statistical analysis through permutation testing has identified certain cell populations that express COL6A3 at significantly higher levels than others .

In adipose tissue, COL6A3 is predominantly expressed in:

  • Fibroblasts and adipocyte progenitor cells

  • Vascular smooth muscle cells

  • Certain subpopulations of immune cells

In coronary arteries, expression is highest in:

  • Fibroblasts/myofibroblasts

  • Smooth muscle cells

  • Modulated smooth muscle cells in disease states

Disease states, particularly obesity and atherosclerosis, show significant alterations in these expression patterns. Under obesogenic conditions, adipose tissue shows increased COL6A3 expression, particularly in fibrotic regions. This elevated expression correlates with increased endotrophin production, which further promotes inflammation and fibrosis in a feed-forward loop .

What methodological approaches are most effective for studying the proteolytic processing of COL6A3 to endotrophin?

Studying the proteolytic processing of COL6A3 to endotrophin requires specialized methodological approaches:

  • In vitro cleavage assays:

    • Purified recombinant COL6A3 should be incubated with candidate proteases

    • Products analyzed by SDS-PAGE under reducing conditions

    • Western blotting with domain-specific antibodies to identify cleavage products

  • Mass spectrometry approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify precise cleavage sites

    • MALDI-TOF for molecular weight determination of fragments

  • Cell-based assays:

    • Expression systems with COL6A3 wild-type and cleavage site mutants

    • Pulse-chase experiments to track processing kinetics

    • Protease inhibitor panels to identify responsible enzymes

  • Domain-specific detection:

    • Utilizing domain-specific aptamers or antibodies as demonstrated in proteomic studies

    • SomaScan v4 assay with aptamers targeting C-terminal (aa 3108-3165) and N-terminal regions (aa 26-1036)

    • Olink Explore 3072 assay with polyclonal antibody targeting C-terminal Kunitz domain

When analyzing endotrophin specifically, researchers should consider the linkage disequilibrium between cis-pQTLs (protein quantitative trait loci) identified in different studies, as this information can help distinguish genetic variants affecting either the full-length protein or specific processed fragments .

How can researchers effectively distinguish between the effects of full-length COL6A3 versus the endotrophin fragment in experimental systems?

Distinguishing between full-length COL6A3 and endotrophin effects requires careful experimental design:

  • Domain-specific reagents:

    • Use antibodies/aptamers specific to either the N-terminal or C-terminal domains

    • Employ the same domain-specific approach used in large-scale proteomic studies

  • Recombinant protein comparisons:

    • Design experiments comparing full-length COL6A3 with recombinant endotrophin fragment

    • Include appropriate concentration curves to account for molar equivalence

    • Control for potential conformational differences between recombinant and naturally processed endotrophin

  • Genetic approaches:

    • Generate cell lines expressing cleavage-resistant COL6A3 (mutation at the endotrophin cleavage site)

    • Compare with wild-type COL6A3-expressing cells

    • Use CRISPR-based approaches to create precise mutations

  • Biomarker analysis:

    • Use cis-pQTLs identified in studies such as UK Biobank and deCODE to differentiate genetic variants affecting C-terminal versus N-terminal domains

    • Consider the linkage disequilibrium patterns between these variants (e.g., rs1050785 from UK-Biobank shows high LD (R² = 0.73) with rs11677932 from the C-terminal-targeting aptamer, but no LD (R² = 0.0) with rs2646260 from the N-terminal-targeting aptamer)

These approaches can help researchers attribute observed biological effects to either the full-length protein or specifically to the endotrophin fragment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.