Recombinant Human Consortin (CNST)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNST; C1orf71; Consortin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-725
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CNST
Target Protein Sequence
MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGK PQVSEQDSLNNNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGT AKKIPPGLFSGDIAPLMQEKVLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGE VEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKT VQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHKIAAVEKSQERKCSTQLLVSE DPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPSLSVTAGKDHM EELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAED PKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNE LNELQQPDLTDSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQL NKETEDYLNSLLEGCLKDTEDSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLS LDDLAKRIEIAEVVPTEGLVSILKKRNDTVGDHPAQMQHKPSKRRVRFQEIDDSLDQDEV GGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDFADNMDFYYTKLLQGVAELKH WIYLS
Uniprot No.

Target Background

Function
Essential for targeting connexins to the plasma membrane.
Gene References Into Functions
  1. Consortin functions as a trans-Golgi network cargo receptor, crucial for the plasma membrane targeting and recycling of connexins. PMID: 19864490
Database Links

HGNC: 26486

OMIM: 613439

KEGG: hsa:163882

STRING: 9606.ENSP00000355470

UniGene: Hs.368353

Protein Families
CNST family
Subcellular Location
Cell membrane; Single-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle. Note=Located predominantly in the trans-Golgi network. Probably trafficks between the trans-Golgi network and the cell membrane via the secretory pathway.

Q&A

What is Recombinant Human Consortin (CNST) and what is its role in cellular function?

Recombinant Human Consortin (CNST) is an integral membrane protein that functions as a binding partner of connexins, which are the fundamental building blocks of gap junctions. It acts as a trans-Golgi network (TGN) receptor involved in connexin targeting to the plasma membrane and recycling from the cell surface . CNST plays a crucial role in protein trafficking pathways, particularly for connexins.

To study this protein's function, researchers should first establish baseline expression levels in their cellular model of interest using quantitative PCR and western blotting. When designing experiments to investigate CNST function, consider implementing the five key steps of experimental design: 1) clearly define your variables, 2) formulate a specific hypothesis about CNST function, 3) design treatments to manipulate CNST expression or activity, 4) properly assign experimental subjects to control and treatment groups, and 5) establish reliable methods to measure the dependent variables .

What experimental models are best suited for studying CNST function?

The selection of experimental models for CNST studies should be guided by your specific research questions. Cell culture models expressing endogenous CNST are preferable for initial characterization studies. For more complex analyses of CNST function in tissue contexts, both in vitro and in vivo models may be necessary.

When designing your experimental approach:

  • Define your variables clearly - CNST expression/activity would typically be your independent variable, while connexin trafficking or gap junction formation would be dependent variables

  • Establish appropriate control groups - including both negative controls (without CNST manipulation) and positive controls (with known modulators of connexin trafficking)

  • Use random assignment when applicable to minimize bias in your results

  • Implement quantitative measurements of your dependent variables using standardized protocols

The experimental design should include both treatment and control groups. For instance, cells with CNST knockdown/knockout compared to wild-type cells would constitute a basic experimental framework .

How is sequence information utilized in recombinant CNST production?

The nucleotide and protein sequence information for CNST is critical for recombinant protein production. According to available data, human CNST has established reference sequences that can be accessed through databases like NCBI . When producing recombinant CNST:

  • The gene can be cloned into expression vectors such as pcDNA3.1-C-(k)DYK or customized vectors

  • The open reading frame (ORF) nucleotide sequence length is approximately 2166bp (based on comparative data from other mammalian species)

  • Expression systems should be selected based on the need for post-translational modifications, with mammalian expression systems preferred for maintaining physiologically relevant protein structure

For expression and purification, consider the following protocol parameters:

ParameterRecommended ConditionsConsiderations
Expression SystemMammalian cell lines (HEK293, CHO)Required for proper folding and modifications
VectorpcDNA3.1 with C-terminal tagFacilitates detection and purification
InductionDepends on promoter usedOptimize for yield vs. toxicity
PurificationAffinity chromatographyBased on fusion tag (e.g., DYKDDDDK tag)
Storage-20~-80°C in pH 7.6 PBSMaintain protein stability

What are the optimal conditions for conducting in vitro studies with Recombinant Human CNST?

When designing in vitro experiments with recombinant CNST, researchers must consider several critical parameters to ensure reliable and reproducible results. Recombinant CNST should be handled according to standardized protocols that maintain protein integrity.

Based on available data, the following experimental conditions are recommended:

  • Storage conditions: Maintain recombinant CNST at -20~-80°C in pH 7.6 PBS to preserve activity

  • Working concentrations: Titrate protein concentration based on your specific assay, typically starting with concentrations of 10-100 ng/mL

  • Validation: Prior to main experiments, validate protein activity using established binding assays with known connexin partners

  • Controls: Include both positive controls (known CNST-interacting proteins) and negative controls (non-relevant proteins)

For interaction studies, consider implementing surface plasmon resonance (SPR) or co-immunoprecipitation assays with the following parameters:

TechniqueParametersExpected OutcomesValidation Method
Co-IP1:100 antibody dilution, 500μg protein lysateDetection of connexin-CNST complexesWestern blot analysis
SPR25-100 nM CNST, pH 7.4 bufferBinding kinetics (KD values)Scatchard analysis
FRETFluorophore-labeled proteins at 1:1 molar ratioEnergy transfer efficiency >10%Acceptor photobleaching

How can researchers validate the specificity and activity of Recombinant Human CNST?

Validating the specificity and activity of recombinant CNST is crucial for experimental reliability. This requires a multi-faceted approach combining structural, functional, and interaction-based validation methods.

Implement the following validation strategy:

  • Structural validation:

    • SDS-PAGE analysis to confirm molecular weight

    • Circular dichroism to assess secondary structure integrity

    • Mass spectrometry to confirm sequence and post-translational modifications

  • Functional validation:

    • Binding assays with known connexin partners

    • Trafficking assays in cellular models

    • Dominant-negative approaches to confirm specificity

  • Antibody-based validation:

    • When using antibodies against CNST, consider replacing animal-derived antibodies with recombinant antibodies for improved reproducibility

    • If applying for the Recombinant Antibody Challenge program, researchers can receive grants for recombinant antibodies to replace animal-derived antibodies, which could be particularly useful for CNST studies

What experimental approaches are most effective for studying CNST trafficking within the trans-Golgi network?

Investigating CNST trafficking within the trans-Golgi network requires sophisticated imaging and biochemical approaches. The most effective experimental strategies combine multiple complementary methods:

  • Live-cell imaging:

    • Fluorescent protein tagging (carefully validate that tags do not interfere with trafficking)

    • Pulse-chase experiments with photoactivatable fluorescent proteins

    • High-resolution confocal microscopy with appropriate markers for Golgi compartments

  • Biochemical fractionation:

    • Density gradient centrifugation to isolate Golgi fractions

    • Selective permeabilization assays to distinguish membrane-associated vs. luminal localization

    • Protease protection assays to determine topology

  • Experimental design considerations:

    • Clearly define your independent variables (e.g., wild-type vs. mutant CNST, drug treatments)

    • Establish appropriate controls for each condition

    • Implement quantitative measurements of trafficking dynamics

    • Use randomization where applicable to reduce bias

For quantitative analysis of trafficking, consider the following parameters:

ParameterMeasurement MethodExpected ValuesControls
Transit timeFluorescence recovery after photobleaching15-30 minutes (cell-type dependent)Temperature blocks (20°C)
Residence timePulse-chase labeling5-15 minutes in TGNBrefeldin A treatment
Export rateVesicle counting in time-lapse imaging2-5 vesicles/minuteDominant-negative Arf1

How can contradictory data regarding CNST function be reconciled in experimental design?

When facing contradictory data about CNST function, researchers should adopt a systematic approach to reconcile discrepancies:

  • Methodological reconciliation:

    • Critically evaluate differences in experimental models (cell types, expression systems)

    • Assess variations in protein constructs (full-length vs. truncated, tag position)

    • Compare detection methods and their sensitivity/specificity limitations

  • Design a comprehensive experimental approach:

    • Follow the five key steps of experimental design: define variables, formulate hypotheses, design treatments, assign subjects properly, and plan measurements carefully

    • Implement both gain-of-function and loss-of-function approaches

    • Use orthogonal methods to validate findings

  • Statistical considerations:

    • Perform power analysis to ensure adequate sample sizes

    • Use appropriate statistical tests based on data distribution

    • Consider meta-analysis approaches if multiple datasets are available

When designing experiments to resolve contradictions, implement the following framework:

Contradiction TypeExperimental ApproachControlsAnalysis Method
Functional discrepanciesSide-by-side comparison in identical modelsPositive and negative controlsBlinded analysis
Localization differencesMulti-modal imaging with quantitative colocalizationCompartment markersPearson's correlation coefficient
Interaction disparitiesIn vitro and in vivo binding assaysCompetition assaysBinding kinetics analysis

What are the best practices for designing knockout or knockdown experiments to study CNST function?

Genetic perturbation experiments are crucial for understanding CNST function. When designing knockout or knockdown studies, consider these methodological best practices:

  • Selection of perturbation method:

    • CRISPR-Cas9 for complete knockout (preferred for long-term studies)

    • siRNA/shRNA for transient knockdown (useful for dose-dependent analyses)

    • Inducible systems for temporal control of expression

  • Experimental design considerations:

    • Define your variables clearly - CNST expression is your independent variable

    • Include appropriate controls (scrambled sequences, non-targeting gRNAs)

    • Use multiple target sequences to control for off-target effects

    • Validate knockdown/knockout efficiency at both mRNA and protein levels

  • Phenotypic analysis:

    • Assess connexin trafficking and gap junction formation

    • Measure functional consequences (e.g., gap junction communication)

    • Perform rescue experiments with wild-type and mutant constructs

When implementing these experiments, follow this validation pipeline:

StageTechniqueSuccess CriteriaTroubleshooting
DesigngRNA/siRNA design toolsMultiple targets, minimal off-target predictionRedesign with higher specificity
ValidationqPCR and Western blot>80% reduction in expressionOptimize transfection/transduction
PhenotypingImmunofluorescence, functional assaysConsistent alterations in connexin localizationConsider compensation mechanisms
RescueComplementation with WT/mutantRestoration of function with WT but not mutantsCheck expression levels of construct

How does post-translational modification affect CNST function in different cellular contexts?

Post-translational modifications (PTMs) of CNST can significantly alter its function across different cellular contexts. To study these modifications:

  • Identification of PTMs:

    • Mass spectrometry-based proteomics for comprehensive PTM mapping

    • Phospho-specific antibodies for known modification sites

    • Metabolic labeling approaches for dynamic PTM analysis

  • Functional assessment:

    • Site-directed mutagenesis of modified residues (phosphomimetic or non-modifiable)

    • Chemical inhibitors of specific PTM enzymes

    • In vitro modification assays to determine effects on binding properties

  • Experimental design considerations:

    • Compare PTM patterns across relevant cell types and conditions

    • Establish cause-effect relationships between modifications and function

    • Consider combinatorial effects of multiple PTMs

How can researchers distinguish between CNST-dependent and CNST-independent connexin trafficking pathways?

Distinguishing between CNST-dependent and independent trafficking pathways requires carefully designed experiments with specific perturbations and readouts:

  • Genetic approaches:

    • CNST knockout/knockdown combined with connexin trafficking assays

    • Expression of dominant-negative CNST mutants

    • Rescue experiments with structure-function analysis

  • Biochemical strategies:

    • Selective inhibition of specific trafficking components

    • Cargo competition assays with known CNST interactors

    • Isolation of transport intermediates at different stages

  • Imaging approaches:

    • Dual-color live imaging of CNST and connexins

    • Super-resolution microscopy to resolve trafficking intermediates

    • Correlative light and electron microscopy for ultrastructural analysis

Implement the following experimental framework to distinguish pathways:

ApproachMethodologyExpected OutcomesInterpretation
Kinetic analysisPulse-chase experimentsDifferent rate constantsPathway-specific kinetics
PerturbationSpecific inhibitors/genetic modificationDifferential sensitivityPathway dependence
InteractionProximity ligation assaySpatial/temporal associationDirect vs. indirect trafficking

What emerging technologies are poised to advance our understanding of CNST biology?

Several cutting-edge technologies are likely to drive significant advances in CNST research:

  • Cryo-electron microscopy for high-resolution structural analysis of CNST-connexin complexes

  • Genome-wide CRISPR screens to identify novel components of CNST-dependent trafficking pathways

  • Quantitative proteomics to map the complete CNST interactome under different conditions

  • Advanced imaging techniques such as lattice light-sheet microscopy for long-term tracking of CNST dynamics

  • Organoid models to study CNST function in tissue-specific contexts

When implementing these advanced approaches, researchers should maintain rigorous experimental design principles , including proper controls, randomization where applicable, and appropriate statistical analyses .

How should researchers approach data integration for comprehensive understanding of CNST function?

As the field generates increasingly diverse datasets on CNST function, integrative approaches become essential:

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and interactomic data

    • Implement computational models of CNST-dependent trafficking

    • Develop predictive algorithms for CNST function in different cellular contexts

  • Cross-disciplinary collaboration:

    • Establish standardized protocols for CNST research

    • Share reagents and models through repositories

    • Implement common data formatting and sharing practices

  • Translational considerations:

    • Connect basic CNST biology to physiological functions

    • Investigate potential disease associations

    • Explore therapeutic targeting opportunities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.