Recombinant Human coronavirus 229E Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
M; 6; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Human coronavirus 229E (HCoV-229E)
Target Names
M
Target Protein Sequence
MSNDNCTGDIVTHLKNWNFGWNVILTIFIVILQFGHYKYSRLFYGLKMLVLWLLWPLVLA LSIFDTWANWDSNWAFVAFSFFMAVSTLVMWVMYFANSFRLFRRARTFWAWNPEVNAITV TTVLGQTYYQPIQQAPTGITVTLLSGVLYVDGHRLASGVQVHNLPEYMTVAVPSTTIIYS RVGRSVNSQNSTGWVFYVRVKHGDFSAVSSPMSNMTENERLLHFF
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Database Links

KEGG: vg:918762

Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the HCoV-229E M protein?

The HCoV-229E Membrane (M) protein is a structural protein incorporated into the viral envelope alongside the Envelope (E) and Spike (S) proteins . The M protein (also known as Matrix glycoprotein or Membrane glycoprotein) plays a critical role in viral assembly and budding of progeny particles, which proceed at the endoplasmic reticulum/Golgi intermediate compartment (ERGIC) . The protein has a theoretical molecular weight of approximately 20.7 kDa when expressed as a recombinant partial protein (residues 96-225) with an N-terminal His-tag . The full M protein is encoded by the M gene corresponding to accession number P15422 .

How does the M protein interact with other structural proteins during virion assembly?

The M protein works synergistically with the E protein to facilitate the assembly and budding of viral particles . While the S protein is primarily responsible for receptor binding and membrane fusion, the M protein forms the structural core of the virion and interacts with the nucleocapsid and viral RNA. The coordinated action of these proteins at the ERGIC membrane allows for efficient production of viral progeny. Research aimed at disrupting these interactions represents a potential avenue for antiviral development that is distinct from approaches targeting viral entry.

What are the optimal expression systems for producing recombinant HCoV-229E M protein?

Expression of recombinant HCoV-229E M protein has been successfully achieved in E. coli systems, as demonstrated by commercially available products . For researchers designing expression constructs, the region spanning amino acids 96-225 has been validated for successful expression . When expressing membrane proteins like M protein, careful consideration should be given to codon optimization, inclusion of appropriate tags (such as N-terminal His-tags for purification), and selection of expression conditions that minimize protein aggregation.

What purification methods yield the highest purity of recombinant M protein?

High-purity recombinant M protein (>85% as determined by SDS-PAGE) can be achieved using standard immobilized metal affinity chromatography (IMAC) when the protein includes an N-terminal His-tag . A multi-step purification protocol typically involves:

  • Initial capture using Ni-NTA columns

  • Washing with increasing imidazole concentrations to remove non-specific binding

  • Elution with high imidazole buffer

  • Further purification via size exclusion chromatography if needed

For membrane proteins, addition of detergents during purification may be necessary to maintain protein solubility and native conformation.

How can researchers verify the functional integrity of recombinant M protein?

Functional verification of recombinant M protein can be assessed through multiple approaches:

  • Structural integrity assessment: Using circular dichroism (CD) spectroscopy to confirm proper secondary structure

  • Oligomerization analysis: Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify proper oligomeric state

  • Interaction studies: Pull-down assays to confirm binding to known viral protein partners (E protein, nucleocapsid)

  • Incorporation into virus-like particles (VLPs): Co-expression with other structural proteins to assess ability to form VLPs

Quality control should include verification of protein purity (>85% by SDS-PAGE) and endotoxin testing for applications involving cell culture .

What methods are recommended for studying M protein interactions with host cell components?

To study M protein interactions with host cell components, researchers can employ:

  • Co-immunoprecipitation: Using tagged M protein to pull down interacting host proteins from cell lysates

  • Proximity labeling: BioID or APEX2 fusion proteins to identify proximal proteins in the cellular environment

  • Fluorescence microscopy: Visualization of M protein localization in relation to cellular compartments using fluorescently tagged constructs

  • Cryo-electron microscopy: For structural studies of M protein complexes, similar to methods used for studying S protein complexes

These approaches can help identify host factors that interact with the M protein during the viral life cycle.

How does the M protein contribute to immune evasion compared to the S protein?

While the S protein of HCoV-229E has been extensively studied for its role in immune evasion through mechanisms such as glycan shielding , the M protein's contribution to immune evasion remains less characterized. The S protein shows clear evidence of evolutionary pressure through increased N-glycosylation sites over time (from 30 in earlier variants to 34 in more recent strains) , suggesting a role in evading neutralizing antibodies.

Research questions surrounding M protein's role in immune evasion could focus on:

  • Identifying M protein epitopes recognized by antibodies in convalescent sera

  • Determining if M protein undergoes similar evolutionary changes to avoid immune recognition

  • Examining whether M protein interactions with host immune components modulate antiviral responses

What are the methodological approaches for comparing M protein function across different coronavirus strains?

Comparative analysis of M proteins across coronavirus strains requires:

  • Sequence alignment analysis: Identifying conserved domains and strain-specific variations

  • Homology modeling: Predicting structural differences based on sequence variations

  • Functional complementation assays: Testing whether M proteins from different strains can functionally substitute for each other in viral assembly assays

  • Chimeric protein studies: Creating M protein chimeras to identify functional domains

This comparative approach could reveal conserved mechanisms that might serve as broad-spectrum antiviral targets.

How can researchers investigate the role of M protein in coronavirus assembly using recombinant proteins?

Investigating M protein's role in viral assembly can be approached through:

  • In vitro assembly systems: Mixing purified recombinant M, E, and N proteins to observe VLP formation

  • Mutagenesis studies: Systematic mutation of M protein domains to identify regions critical for protein-protein interactions

  • Cryo-electron microscopy: Visualizing M protein arrangement in VLPs or authentic virions, building on techniques used for S protein structural studies

  • Live-cell imaging: Following M protein trafficking and assembly using fluorescently tagged constructs

These methodologies can provide insights into the molecular mechanisms of coronavirus assembly.

What are common issues when working with recombinant M protein and how can they be addressed?

Common challenges when working with recombinant coronavirus M protein include:

  • Protein aggregation: Address by optimizing buffer conditions with mild detergents or using fusion partners that enhance solubility

  • Low expression yields: Optimize codon usage, consider using expression tags that enhance folding, or test different host systems beyond E. coli

  • Improper folding: Use membrane mimetics during purification to maintain native conformation

  • Functional inactivity: Verify protein integrity through biophysical characterization before functional assays

Careful consideration of storage conditions (avoiding freeze-thaw cycles) can help maintain protein activity for experimental use .

How should researchers design experiments to differentiate M protein functions from other viral proteins?

To distinguish M protein functions from other viral proteins, consider:

  • Single protein expression systems: Express M protein alone to identify its intrinsic properties

  • Complementation assays: Use M protein knockout systems complemented with wild-type or mutant M proteins

  • Domain swapping: Exchange functional domains between M and other viral proteins to identify unique contributions

  • Temporal inhibition studies: Use inducible expression systems to control M protein expression at different stages of the viral life cycle

These approaches can help delineate the specific contributions of M protein to viral replication and assembly.

How might studies of HCoV-229E M protein inform therapeutic strategies against other coronaviruses?

The M protein represents a conserved target across coronaviruses with potential for broad-spectrum therapeutic development. Unlike the highly variable S protein that shows extensive sequence variation even within HCoV-229E strains , M proteins tend to be more conserved. Research approaches could include:

  • Comparative structural analysis: Identifying conserved structural features that could be targeted by small molecules

  • M protein-targeted antiviral screening: Developing assays to identify compounds that disrupt M protein function in assembly

  • Peptide inhibitors: Designing peptides that mimic critical M protein interaction interfaces

  • Combination approaches: Exploring synergistic effects of targeting both entry (S protein) and assembly (M protein) simultaneously

This multi-target approach could overcome the limitations of S protein-focused strategies that face challenges from viral evolution and immune escape .

What techniques can be used to investigate conformational changes in M protein during the viral life cycle?

Investigating M protein conformational dynamics requires sophisticated biophysical approaches:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions of conformational flexibility

  • Single-molecule FRET: To observe conformational changes in real-time

  • Cryo-EM of assembly intermediates: To capture different states of M protein during virion formation

  • Molecular dynamics simulations: To predict conformational changes based on structural data

These techniques can reveal how M protein transitions between different functional states during viral assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.