Recombinant Human coronavirus 229E Non-structural protein 4a (4a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped standard with blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your request.
Synonyms
4a; Non-structural protein 4a; ns4a; Accessory protein 4a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-133
Protein Length
Full Length of Mature Protein
Species
Human coronavirus 229E (HCoV-229E)
Target Names
4a
Target Protein Sequence
KVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILFV YVPLLYWSQAYIYATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR
Uniprot No.

Target Background

Database Links

KEGG: vg:918759

Protein Families
Coronaviruses NS4a protein family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the ORF4a protein of HCoV-229E and where is it encoded in the viral genome?

The ORF4a protein of HCoV-229E is an accessory protein encoded in a locus between the spike and envelope genes, a region conserved across all coronaviruses. This locus contains either a complete or truncated open reading frame (ORF). In HCoV-229E specifically, this region encodes ORF4a, which functions as a viroporin (virus-encoded ion channel). This genomic location is analogous to the position of the 3a protein in SARS-CoV, suggesting evolutionary conservation of this accessory protein locus across coronavirus lineages .

What cellular localization pattern does the ORF4a protein exhibit?

The ORF4a protein primarily localizes to the endoplasmic reticulum/Golgi intermediate compartment (ERGIC) in infected cells. This localization pattern has been demonstrated through immunofluorescence studies of infected cells and is consistent with the protein's role in viral assembly and egress processes. The ERGIC localization is particularly important given that coronavirus assembly occurs at this cellular compartment, suggesting a functional role for ORF4a in the viral replication cycle .

What is the predicted membrane topology of ORF4a?

Based on bioinformatic analyses, the ORF4a protein is predicted to possess three transmembrane domains (TMDs). This structural organization is conducive to its function as an ion channel, with the transmembrane regions creating a pore through cellular membranes. The presence of multiple transmembrane domains is a common feature among viroporins, enabling them to form channels or pores in host cell membranes .

How does ORF4a form functional oligomeric structures?

The ORF4a protein forms homo-oligomeric structures through disulfide bridges. Biochemical analyses have revealed that these oligomers are stabilized by covalent disulfide linkages between cysteine residues. This oligomerization is critical for ion channel function, as the assembled protein complex creates a pore through which ions can pass. The oligomeric nature of ORF4a resembles that of other viral ion channels, particularly the SARS-CoV 3a protein, which also forms multimeric structures .

What ion selectivity properties does the ORF4a channel exhibit?

Experimental evidence from two-electrode voltage clamp (TEVC) studies in Xenopus oocytes indicates that ORF4a forms a non-selective channel for monovalent cations. The channel shows conductance for various monovalent cations, although lithium ions (Li+) partially reduce the inward current, suggesting some degree of ion selectivity. This ion channel activity has been confirmed through complementary approaches including the yeast potassium uptake complementation assay .

How does suppression of ORF4a affect viral replication?

When ORF4a protein expression is suppressed using siRNA in infected human hepatocellular carcinoma (Huh-7) cells, viral production significantly decreases. This finding demonstrates that ORF4a plays an important role in the HCoV-229E life cycle, particularly in viral production and release. The reduction in viral titers following ORF4a suppression suggests this protein is a potential target for antiviral strategies .

What expression systems are suitable for recombinant ORF4a production?

For recombinant ORF4a protein production, researchers have successfully utilized mammalian expression systems. The ORF4a coding sequence can be cloned into vectors such as pCAGGS for efficient expression in mammalian cells. For detection and purification purposes, epitope tags (HA or Flag) are commonly added to the C-terminus of the protein. The pNWP vector has also been used for certain applications involving ORF4a-HA constructs .

For RNA extraction from HCoV-229E infected cells, Trizol reagent is commonly employed following the manufacturer's protocol. cDNA synthesis can be performed using the ReverTra Ace qPCR RT kit, which provides a reliable template for subsequent cloning procedures .

What electrophysiological methods are used to characterize ORF4a ion channel activity?

Ion channel activity of recombinant ORF4a can be assessed using the two-electrode voltage clamp (TEVC) technique in Xenopus oocytes. This method allows for direct measurement of membrane currents and assessment of ion selectivity by testing conductance to different monovalent cations. Additionally, the yeast potassium uptake complementation assay serves as a functional test for ion channel activity in a cellular context .

How can researchers investigate the oligomeric state of ORF4a?

The oligomeric state of ORF4a can be investigated using biochemical approaches that detect disulfide-linked complexes. Techniques such as non-reducing SDS-PAGE followed by Western blotting can reveal the presence of higher molecular weight species corresponding to ORF4a oligomers. Treatment with reducing agents disrupts these complexes, confirming the role of disulfide bridges in maintaining the oligomeric structure .

How does ORF4a compare functionally to the SARS-CoV 3a protein?

The HCoV-229E ORF4a protein has been identified as functionally analogous to the SARS-CoV 3a protein. Both proteins:

  • Are encoded at similar genomic positions between the spike and envelope genes

  • Form ion channels (viroporins)

  • Regulate virus production and release

  • Form oligomeric structures

This functional homology suggests a conserved role for these accessory proteins across different coronavirus lineages despite limited sequence conservation .

What is known about similar accessory proteins in animal coronaviruses?

Accessory proteins encoded at the corresponding genomic locus in animal coronaviruses such as porcine epidemic diarrhea virus (PEDV) and transmissible gastroenteritis virus (TGEV) have been implicated in viral pathogenicity. The ORF3 proteins from these viruses are thought to contribute to virulence and host adaptation, suggesting a conserved role for these accessory proteins in coronavirus evolution and host-pathogen interactions .

How has the glycosylation profile of HCoV-229E evolved over time?

Phylogenetic analysis of HCoV-229E variants reveals an evolutionary trend toward increasing numbers of potential N-glycosylation sites in the viral spike protein. While the P100E variant harbors 30 N-glycosylation sites, the more recent Seattle strain contains 34 such sites. This progressive acquisition of glycosylation sites resembles patterns observed in other viruses like influenza and may represent a general evolutionary strategy for coronaviruses to enhance immune evasion through glycoshielding .

What implications does ORF4a have for developing antiviral strategies?

Given its role in regulating virus production, ORF4a represents a potential target for developing drugs against HCoV-229E. Inhibition of ORF4a ion channel activity could disrupt viral replication and release, similar to strategies targeting other viral ion channels such as the M2 protein of influenza virus. Understanding the structure and function of ORF4a will be helpful for understanding HCoV-229E pathogenesis and for rational drug design .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.