Recombinant Human coronavirus HKU1 Membrane protein (M)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Characterization

The recombinant M protein is produced using heterologous expression systems, with two primary approaches:

Production MethodDetails
E. coli ExpressionFull-length (1–223aa) protein with an N-terminal His tag; >90% purity . Lyophilized or stored in Tris/PBS buffer with trehalose.
Mammalian Cell ExpressionPartial-length M protein; >85% purity. Used for studying protein interactions .

Key specifications for the E. coli-expressed protein include:

  • Sequence: MNESIFPHWNSDQAITFLKEWNFSLGVILLLITIILQFGYTSRSMFVYLIKMIILWLMWP LTIILTIFNCFYALNNIFLGLSILFTIISIVIWILYFVNSIRLFIRTGSWWSFNPETNNL MCIDMKGKMYVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLADLPVYVTVAKVQVLCT YKRAFLDKLDVNSGFAVFVKSKVGNYRLPSSKSSGMDTALLRA .

  • Applications: Used in structural studies, vaccine development, and diagnostic assays .

Role in Viral Assembly and Pathogenesis

The M protein is indispensable for coronavirus replication:

  • Assembly: Mediates interactions between the viral envelope (E and S proteins) and nucleocapsid (N protein) . Mutations in the conserved domain (CD) of the M protein disrupt virus-like particle (VLP) formation, highlighting its role in lateral interactions .

  • Pathogenesis: While the M protein of SARS-CoV induces interferon responses via RIG-I, HCoV-HKU1 M protein does not exhibit similar activity, suggesting species-specific immune evasion mechanisms .

Glycosylation Patterns

The ectodomain of HCoV-HKU1 M protein is modified by N-linked glycosylation, unlike HCoV-OC43, which uses O-linked glycosylation . This distinction may influence viral tropism and immune recognition.

Interaction with Host Proteins

  • N Protein: The nucleocapsid protein stabilizes M protein complexes during assembly, particularly in mutants with disrupted transmembrane domains .

  • S Protein: The M protein interacts with the S protein’s cytoplasmic tail to facilitate virion budding .

Functional Domains

The conserved domain (CD) in the transmembrane region is critical for:

  • VLP Formation: Mutations in the CD (e.g., E121K) abolish VLP production, while compensatory mutations in the N protein restore functionality .

  • Membrane Curvature: Collaborates with the E protein to induce membrane curvature during budding, as shown in molecular dynamics simulations .

Disease Implications and Diagnostic Potential

  • Vaccine Development: Recombinant M protein is explored as a subunit vaccine candidate due to its abundance and structural role .

  • Diagnostic Tools: Used in Western blot assays to detect anti-M antibodies in patient sera .

Comparative Analysis with Other Coronaviruses

FeatureHCoV-HKU1SARS-CoVHCoV-OC43
M Protein GlycosylationN-linked N-linkedO-linked
Interferon InductionNo Yes (via RIG-I) Not reported
VLP FormationDependent on CD Dependent on CDDependent on CD

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
M; 6; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)
Target Names
M
Target Protein Sequence
MNESIFPHWNSDQAITFLKEWNFSLGVILLLITIILQFGYTSRSMFVYLIKMIILWLMWP LTIILTIFNCFYALNNVFLGLSILFTIISIVIWILYFVNSIRLFIRTGSWWSFNPETNNL MCIDMKGKMYVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLADLPVYVTVAKVQVLCT YKRAFLDKLDVNSGFAVFVKSKVGNYRLPSSKSSGMDTALLRA
Uniprot No.

Target Background

Function

A component of the viral envelope, this protein plays a crucial role in viral morphogenesis and assembly through its interactions with other viral proteins.

Protein Families
Betacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the Human coronavirus HKU1 Membrane protein and what are its key structural features?

Human coronavirus HKU1 (HCoV-HKU1) Membrane (M) protein is a structural glycoprotein with three N-terminal transmembrane domains (TM1, TM2, and TM3) and a cytoplasmic endodomain. The protein is essential for viral assembly and budding. The M protein of HCoV-HKU1 shares 76-84% amino acid identity with M proteins of other group 2 coronaviruses but less than 40% amino acid identity with M proteins from other coronavirus groups . The protein contains multiple domains with the N-terminal transmembrane region being particularly important for protein localization and function .

How does HCoV-HKU1 M protein differ from SARS-CoV M protein in terms of interferon antagonism?

Unlike SARS-CoV M protein, HCoV-HKU1 M protein does not suppress type I interferon (IFN) production. This represents a significant functional difference between these two coronavirus M proteins. The IFN-antagonizing activity of SARS-CoV M protein is specifically mediated through its first transmembrane domain (TM1) located at the N terminus. SARS-CoV M protein suppresses IFN production by preventing the formation of functional TRAF3-TANK-TBK1/IKKε complex, while HCoV-HKU1 M protein lacks this capability. This difference may contribute to the varying pathogenicity between SARS-CoV and HCoV-HKU1 .

What expression systems are available for producing recombinant HCoV-HKU1 M protein?

Several expression systems can be used to produce recombinant HCoV-HKU1 M protein, including:

  • E. coli: Provides high yield but may lack proper post-translational modifications

  • Yeast: Offers eukaryotic processing with moderate yields

  • Baculovirus: Enables expression in insect cells with improved folding

  • Mammalian cell systems: Provides the most native-like post-translational modifications

Each system has specific advantages depending on the research application. For studies requiring properly glycosylated protein, mammalian expression systems are preferred, while E. coli systems may be suitable for structural studies requiring higher yields .

What purification strategies are most effective for recombinant HCoV-HKU1 M protein?

For purification of recombinant HCoV-HKU1 M protein, affinity chromatography methods are commonly employed. The addition of specific tags (such as His-tag) facilitates purification:

  • For His-tagged proteins, Ni²⁺-loaded HiTrap chelating systems are effective

  • For Fc-fusion proteins, protein A-based affinity chromatography yields high purity

Typical purification protocols include:

  • Initial capturing using affinity chromatography

  • Further purification by ion-exchange or size-exclusion chromatography

  • Final purity assessment by SDS-PAGE (>85% purity is typically achieved)

After purification, proper storage in the presence of glycerol (5-50%) and aliquoting for long-term storage at -20°C/-80°C is recommended to maintain protein stability .

What cell culture systems are suitable for studying HCoV-HKU1 infection and the role of M protein?

HCoV-HKU1 is notably difficult to culture in standard cell lines. The recommended system for studying HCoV-HKU1 infection is:

Human Airway Epithelial (HAE) cell cultures: This is currently the only reliable in vitro model for HCoV-HKU1 replication. These primary cell cultures recapitulate the morphology, biochemistry, and physiology of human airway epithelium.

Protocol overview:

  • Prepare well-differentiated HAE cultures at air-liquid interface

  • Wash the apical surface with PBS three times

  • Inoculate with HCoV-HKU1 clinical samples or viral stock (diluted 1:2 or 1:10)

  • Incubate at 32°C for 2 hours

  • Remove unbound virus by washing

  • Maintain cultures at air-liquid interface at 32°C

  • Collect apical washes at specific time points to assess viral replication

This system has been crucial for understanding HCoV-HKU1 biology since the virus remains unculturable in most laboratories using immortalized cell lines .

How can researchers quantify HCoV-HKU1 replication in experimental systems?

Quantification of HCoV-HKU1 replication can be performed using:

  • Real-time quantitative PCR (qPCR):

    • Target: N gene of HCoV-HKU1

    • Primers: HKUqPCR5 (5′-CTGGTACGATTTTGCCTCAA-3′) and HKUqPCR3 (5′-CAATCACGTGGACCCAATAAT-3′)

    • Probe: HKUqPCRP (5′-FAM-TTGAAGGCTCAGGAAGGTCTGCTTCTAA-TAMRA-3′)

    • Amplification conditions: 2 min at 50°C, 10 min at 95°C, followed by 45 cycles of 15s at 95°C and 60s at 60°C

  • Northern blot analysis: For detection of viral genomic and subgenomic RNAs

  • Electron microscopy: For visualization of virus particles

  • Immunofluorescence assays: Using specific antibodies against viral proteins

These methods can be combined to comprehensively assess viral replication kinetics, with qPCR being particularly valuable for quantitative analysis of viral genome copy numbers .

How many genotypes of HCoV-HKU1 have been identified and how does this affect the M protein?

Three distinct genotypes of HCoV-HKU1 have been identified:

  • Genotype A

  • Genotype B

  • Genotype C (resulting from recombination between genotypes A and B)

The recombination events that led to genotype C involved:

  • Recombination between genotypes B and C at the nsp6-nsp7 junction (nucleotide positions 11750-11892)

  • Recombination between genotypes A and B at the nsp16-HE junction (nucleotide positions 21502-21530)

This genomic diversity requires researchers to consider the genotype when working with the M protein, as variations may affect functional studies. The recombination events represent the first documented evidence for natural recombination in coronaviruses associated with human infection .

What methodological approaches should be used for genotyping HCoV-HKU1 strains?

For proper genotyping of HCoV-HKU1 strains, it is insufficient to sequence a single gene. The recommended approach includes:

  • Amplification and sequencing of at least two gene loci:

    • One from the nsp10 to nsp16 region (e.g., pol or helicase genes)

    • Another from the HE to N region (e.g., spike or N genes)

  • Additional characterization of the acidic tandem repeat (ATR) region in nsp3:

    • Number of perfect 30-base ATR (encoding NDDEDVVTGD)

    • Sequence and number of imperfect repeats

  • Phylogenetic analysis comparing the sequences to reference strains

The complex recombination history of HCoV-HKU1 makes this multi-locus approach necessary for accurate genotyping and strain characterization .

How does the HCoV-HKU1 M protein compare to other coronavirus M proteins in cell signaling modulation?

Unlike SARS-CoV M protein, which potently suppresses type I interferon (IFN) production, HCoV-HKU1 M protein lacks this IFN-antagonizing property. The functional differences include:

  • TRAF3 complex interaction: SARS-CoV M protein associates with TRAF3, TANK, TBK1, and IKKε, preventing the formation of functional signaling complexes. HCoV-HKU1 M protein does not demonstrate this capability.

  • Transmembrane domain 1 (TM1) specificity: The N-terminal TM1 of SARS-CoV M protein (amino acids 1-38) mediates IFN antagonism. There is only 26% amino acid identity between the TM1 regions of SARS-CoV and HCoV-HKU1 M proteins.

  • Subcellular localization: SARS-CoV M protein localizes to the Golgi apparatus via TM1, sequestering signaling proteins. The different TM1 sequence of HCoV-HKU1 M protein may affect its localization and function.

These differences likely contribute to the varying disease severity caused by different coronaviruses and suggest HCoV-HKU1 may have adapted differently to human hosts .

What methods are available for studying protein-protein interactions involving HCoV-HKU1 M protein?

Several methodologies can be employed to study HCoV-HKU1 M protein interactions:

  • Co-immunoprecipitation assays:

    • Express tagged M protein in mammalian cells

    • Lyse cells under non-denaturing conditions

    • Precipitate using tag-specific antibodies

    • Identify interacting partners by Western blotting or mass spectrometry

  • Confocal microscopy for co-localization studies:

    • Co-express fluorescently tagged M protein with potential partners

    • Analyze subcellular localization and co-localization using markers such as GM130 (Golgi) or calnexin (ER)

  • Yeast two-hybrid screening:

    • Use M protein domains as bait to identify novel interacting proteins

    • Validate interactions using alternative methods

  • Bimolecular fluorescence complementation (BiFC):

    • Express M protein fused to one half of a fluorescent protein

    • Express potential interacting partner fused to complementary half

    • Interaction brings the halves together, restoring fluorescence

These approaches can reveal host cell factors that interact with the M protein during viral replication and assembly .

What antibody responses are elicited against HCoV-HKU1 M protein during natural infection?

During natural HCoV-HKU1 infection, patients develop antibody responses against viral proteins including the M protein. The antibody dynamics show:

  • Seroconversion timeline:

    • IgM antibodies appear in the first week of illness (titers of 1:20)

    • IgM titers increase in the second week (1:40)

    • IgM peaks by the fourth week (1:80)

    • IgG antibodies show sequential increase from <1:1,000 to 1:8,000 over four weeks

  • Atypical antibody dynamics:

    • Some patients (31-46%) show significant antibody increases between acute and convalescent phases

    • Interestingly, a substantial proportion (57% in one study) can exhibit a significant decrease in antibodies at convalescent phase

    • This unusual pattern differs from typical serological responses seen with other respiratory viruses

Antibody levels can be measured using ELISA, Luminex assays, or other immunoassays with recombinant viral proteins as antigens .

What are the most sensitive methods for detecting HCoV-HKU1 M protein antibodies in research settings?

For detection of antibodies against HCoV-HKU1 M protein, several methodologies have been developed with varying sensitivity and specificity:

  • Enzyme-Linked Immunosorbent Assay (ELISA):

    • Using recombinant M protein expressed in E. coli, yeast, or mammalian cells

    • Sensitivity depends on the coating antigen and detection system

    • Dilution series: 1:10,000 for serum samples is often used

  • Luminex bead-based assays:

    • Couple recombinant M protein to Luminex Magplex beads using carbodiimide chemistry

    • Detection with Goat-anti-human IgG-PE secondary antibodies

    • Readout as Median Fluorescence Intensity

    • Fold change calculation: ratio of convalescent to acute phase values

    • Cutoff values: typically 2.01 for significant antibody rise and 0.23 for antibody decrease

  • Western blot analysis:

    • Using purified recombinant M protein

    • Allows detection of antibodies to linear epitopes

Including proper controls (positive and negative) and standardizing cutoff values are essential for reliable antibody detection. Cross-reactivity with other coronavirus M proteins should be evaluated and controlled for in assay development .

How can recombinant HCoV-HKU1 M protein be used to study virus-host interactions at the molecular level?

Recombinant HCoV-HKU1 M protein can be utilized in several advanced approaches to investigate virus-host interactions:

  • Reverse genetics systems:

    • Introduce mutations in M protein to assess functional consequences

    • Create chimeric M proteins (e.g., swapping domains with other coronaviruses) to identify functional domains

  • Proteomic approaches:

    • Identify host proteins that interact with M protein using pull-down assays followed by mass spectrometry

    • Compare interactomes of M proteins from different coronavirus strains to understand pathogenicity differences

  • Single-particle cryo-electron microscopy:

    • Determine high-resolution structures of M protein alone or in complex with other viral components

    • Understand conformational changes during virus assembly

  • CRISPR/Cas9 screening:

    • Identify host factors essential for M protein function

    • Screen for cellular pathways modulated by M protein expression

  • RNA-Seq and ribosome profiling:

    • Assess transcriptional and translational changes induced by M protein expression

    • Compare with other coronavirus M proteins to identify unique signatures

These approaches can reveal how the M protein contributes to viral replication, assembly, and modulation of host responses .

What are the challenges in studying the structure of HCoV-HKU1 M protein and how can they be overcome?

Studying the structure of HCoV-HKU1 M protein presents several challenges that can be addressed through specialized approaches:

  • Challenges:

    • Membrane proteins are difficult to express and purify in their native conformation

    • The hydrophobic transmembrane domains tend to aggregate

    • Expression levels are often low

    • Protein may adopt different conformations in different membrane environments

  • Solutions:

    • Advanced expression systems:

      • Use specialized strains (C41/C43) for E. coli expression

      • Cell-free expression systems with membrane mimetics

      • Mammalian cell expression for native glycosylation

    • Purification strategies:

      • Solubilization with mild detergents (DDM, LMNG)

      • Nanodiscs or styrene maleic acid lipid particles (SMALPs) to maintain membrane environment

      • Amphipols for stabilization

    • Structural determination:

      • Single-particle cryo-electron microscopy rather than crystallization

      • NMR studies of individual domains

      • Molecular dynamics simulations to model membrane interactions

      • Hydrogen-deuterium exchange mass spectrometry to probe dynamics

    • Functional verification:

      • Liposome reconstitution assays

      • Electron microscopy of virus-like particles

By combining these approaches, researchers can overcome the inherent difficulties of membrane protein structural biology to gain insights into M protein structure and function .

Does the HCoV-HKU1 M protein play a role in viral receptor binding and entry?

The HCoV-HKU1 M protein does not appear to play a direct role in receptor binding and entry, unlike the spike (S) protein which is the primary mediator of these processes. Key findings include:

  • The spike protein of HCoV-HKU1 binds to O-acetylated sialic acid residues on glycoproteins as a cellular attachment receptor determinant .

  • The hemagglutinin-esterase (HE) protein, not the M protein, acts as a receptor-destroying enzyme with sialate-O-acetylesterase activity, capable of eliminating binding sites for the S protein .

  • Studies comparing the binding of various recombinant viral proteins to susceptible cells (such as RD cells) have not demonstrated direct binding of the M protein to cell surfaces .

  • The M protein likely functions in later stages of the viral life cycle, particularly in viral assembly and morphogenesis, rather than in the initial attachment and entry process.

This differs from the extensively studied interactions between TMPRSS2 and the spike protein, which are crucial for viral entry through proteolytic activation .

How do researchers investigate the role of viral proteins in HCoV-HKU1 entry using HAE cultures?

To investigate viral entry mechanisms using the Human Airway Epithelial (HAE) culture system, researchers employ several methodological approaches:

  • Receptor blocking experiments:

    • Pretreat HAE cultures with antibodies against potential receptors

    • Apply recombinant viral proteins (such as the HE protein) to block receptor binding sites

    • Quantify the effect on viral infection using qPCR to measure viral genomic RNA

  • Enzyme pretreatment assays:

    • Treat HAE cells with neuraminidase to remove sialic acids

    • Apply sialate-O-acetylesterase active or inactive HE proteins

    • Compare viral replication efficiency between treated and untreated cultures

  • Viral protein competition assays:

    • Express individual viral proteins in HAE cells

    • Challenge with whole virus to assess competitive inhibition

    • Determine which proteins interfere with viral entry

  • Microscopy and immunofluorescence:

    • Track virus binding and entry using labeled virus particles

    • Identify infected cell types (HCoV-HKU1 preferentially infects ciliated cells)

    • Co-localize viral proteins with cellular markers during entry process

These approaches have revealed that O-acetylated sialic acid residues are critical for HCoV-HKU1 infection of HAE cells, and that the HE protein with its sialate-O-acetylesterase activity can function as a receptor-destroying enzyme, significantly reducing viral infection when used as pretreatment .

What protein modifications and tags can be added to recombinant HCoV-HKU1 M protein for research applications?

Several protein modifications and tags can be incorporated into recombinant HCoV-HKU1 M protein to facilitate research applications:

  • Affinity tags:

    • His₆-tag: For purification using nickel-based affinity chromatography

    • GST-tag: For improved solubility and glutathione-based purification

    • MBP-tag: For enhanced solubility and amylose resin purification

    • Fc-fusion: For protein A/G-based purification and enhanced stability

    • Avi-tag: For site-specific biotinylation and streptavidin-based applications

  • Fluorescent protein fusions:

    • GFP/mCherry/mScarlet: For subcellular localization studies

    • Split fluorescent proteins: For bimolecular fluorescence complementation assays

  • Epitope tags:

    • FLAG, HA, c-Myc, V5: For detection with commercial antibodies

    • Multiple epitope tags can be combined for tandem affinity purification

  • Cleavage sites:

    • TEV, PreScission, or thrombin sites: For tag removal after purification

    • Furin cleavage sites: For studying protein processing

  • In vivo biotinylation:

    • BirA ligase-mediated biotinylation of AviTag

    • Enables highly specific avidin/streptavidin-based applications

The tag placement (N-terminal, C-terminal, or internal) requires careful consideration, as the transmembrane topology of the M protein may affect accessibility and function of the tags .

What strategies can be used to improve the solubility and stability of recombinant HCoV-HKU1 M protein?

Improving the solubility and stability of recombinant HCoV-HKU1 M protein requires specialized approaches due to its transmembrane nature:

  • Expression strategies:

    • Express individual domains rather than full-length protein

    • Use fusion partners known to enhance solubility (MBP, SUMO, Thioredoxin)

    • Lower expression temperature (16-20°C) to slow folding

    • Use specialized expression hosts optimized for membrane proteins

  • Solubilization approaches:

    • Screen multiple detergents (DDM, LMNG, OG, CHAPS) for optimal extraction

    • Use lipid nanodiscs or SMALPs to maintain native-like environment

    • Apply gentle solubilization conditions to preserve protein structure

  • Buffer optimization:

    • Test various pH ranges (typically pH 7.0-8.0)

    • Include glycerol (5-50%) to prevent aggregation

    • Add stabilizing agents such as arginine or trehalose

    • Incorporate specific lipids that interact with the protein

  • Storage conditions:

    • Lyophilize with appropriate cryoprotectants

    • Store at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles

    • For working stocks, maintain at 4°C with preservatives

  • Protein engineering:

    • Identify and mutate aggregation-prone regions

    • Remove flexible regions that may promote degradation

    • Introduce stabilizing disulfide bonds or salt bridges

Combining these approaches can significantly improve the yield and quality of recombinant M protein preparations for structural and functional studies .

How does HCoV-HKU1 M protein compare structurally and functionally with M proteins from other human coronaviruses?

The HCoV-HKU1 M protein shares similarities and differences with M proteins from other human coronaviruses:

These differences likely contribute to the distinct pathogenic profiles of different human coronaviruses, with HCoV-HKU1 generally causing milder disease compared to SARS-CoV .

What can be learned from studying HCoV-HKU1 M protein that might be applicable to understanding other coronavirus M proteins?

Studying HCoV-HKU1 M protein offers several insights that could advance our understanding of coronavirus M proteins more broadly:

  • Evolutionary adaptations:

    • Comparing M proteins from HCoV-HKU1 (causing mild disease) with those from SARS-CoV and MERS-CoV (causing severe disease) can reveal how evolutionary adaptations in M proteins might influence pathogenicity

    • Analysis of the three HCoV-HKU1 genotypes provides insight into natural recombination events affecting structural proteins

  • Structure-function relationships:

    • Identifying conserved vs. variable regions across coronavirus M proteins helps pinpoint domains critical for universal coronavirus functions

    • Understanding how specific domains (like TM1 in SARS-CoV) confer unique properties can reveal mechanisms of coronavirus pathogenesis

  • Host interaction patterns:

    • The lack of interferon antagonism in HCoV-HKU1 M protein, in contrast to SARS-CoV M protein, suggests differential evolution of immune evasion strategies

    • This may represent a model of how coronaviruses adapt to human hosts over time, with more established human coronaviruses possibly losing some immunosuppressive tools

  • Methodological advances:

    • Techniques developed for expressing and studying the challenging HCoV-HKU1 M protein can be applied to other coronavirus membrane proteins

    • The HAE culture system validated with HCoV-HKU1 provides a platform for studying other difficult-to-culture coronaviruses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.