The E protein is integral to multiple stages of the HCoV-NL63 lifecycle:
Facilitates virion morphogenesis by integrating into the endoplasmic reticulum–Golgi intermediate compartment (ERGIC) membrane .
Absence of E protein results in defective virion assembly and reduced infectivity .
Forms homopentameric or dimeric pores in lipid bilayers, enabling cation transport (e.g., Ca²⁺) .
Structural studies reveal that the TMD of HCoV-NL63 E protein adopts an α-helical conformation but lacks pH- or Ca²⁺-responsive gating mechanisms seen in SARS-CoV-2 .
Interacts with host PDZ-domain proteins (e.g., PALS1) via its PBM, disrupting cell junctions and promoting viral spread .
Modulates NLRP3 inflammasome activity: suppresses early immune responses but exacerbates inflammation in advanced infection stages .
Recombinant E protein induces TNF-α and IFN-γ secretion in vitro, mimicking inflammatory responses observed during natural infection .
NLRP3 inflammasome activation is linked to its ion channel function, providing insights into cytokine storm mechanisms .
The TMD’s conserved Phe residues (F22-F25-F28) are potential targets for channel-blocking antivirals .
Structural NMR data reveal that oligomeric state (dimer vs. pentamer) affects drug binding efficacy .
This recombinant HCoV-NL63 E protein is produced using a cell-free in vitro expression system in E. coli. In this system, protein synthesis occurs in vitro using extracts from whole cells compatible with translation. These extracts contain all the necessary molecules and enzymes for transcription, translation, and post-translational modifications of the recombinant protein. With the addition of supplemental cofactors, E protein synthesis can be achieved within a few hours. However, this system may not be suitable for large-scale protein production. The advantages of this system include the ability to synthesize proteins without cell culturing and the potential to express multiple proteins simultaneously.
The HCoV-NL63 E protein is a small, integral, structural membrane protein embedded within the lipid envelope of mature viral particles. It plays crucial roles in various stages of the viral life cycle, including assembly, budding, envelope formation, and pathogenesis. The absence or inactivation of E protein leads to attenuated viruses, likely due to alterations in virion morphology or tropism. While the E protein is abundantly expressed inside infected cells during replication, only a small fraction is integrated into the virion membrane. The majority of the E protein is found in intracellular trafficking sites, such as the ER, Golgi, and ERGIC, where it assists in HCoV-NL63 assembly and budding. The E protein also plays a significant role in viral production and maturation.KEGG: vg:2943502
The HCoV-NL63 E protein is a small, integral membrane protein comprising 77 amino acids with the sequence: MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV . The protein adopts an N-ecto/C-endo topology, meaning the N-terminus is located outside the virus (ectodomain) while the C-terminus is positioned inside (endodomain) . The transmembrane domain (TMD) spans approximately from residues G10 to K34, forming a regular α-helical conformation that remains stable across different pH conditions and is largely unaffected by the presence of the ectodomain . The C-terminal residues 35LIQ37 show less α-helical character and likely belong to the cytoplasmic domain rather than the transmembrane region .
The transmembrane domain of HCoV-NL63 E protein exhibits important structural differences compared to beta-coronaviruses like SARS-CoV and SARS-CoV-2:
Polar Residue Motif: NL63 ETM contains a 7DDN9 motif, which differs from the corresponding 7EET9 motif in SARS-CoV and SARS-CoV-2. This difference in sidechain charge and length makes the NL63 motif less responsive to changes in pH and Ca²⁺ ions .
Phenylalanine Arrangement: NL63 ETM has three consecutive phenylalanine residues (24FFF26) that face different orientations of the helices. In contrast, SARS-CoV ETM has three Phe residues positioned three residues apart (20FxxFxxF26), which can stack along the helix axis and likely serve as a gate for cation conduction .
α-Helical Conformation: NL63 ETM maintains a regular α-helical conformation without discernible helical disorder in the middle of the TM segment, unlike SARS-CoV-2 ETM which shows helical disorder where the three regularly spaced Phe residues are present .
These structural differences likely explain the functional variations observed between alpha and beta coronavirus E proteins.
Water accessibility is a critical factor in determining the ion channel properties of viroporins including HCoV-NL63 E protein. Research using water-edited NMR spectroscopy shows that:
At neutral pH, NL63 ETM shows an average water-transferred intensity of ~0.16, which increases only modestly to ~0.21 at acidic pH in the presence of Ca²⁺ ions .
This is in stark contrast to SARS-CoV-2 ETM, which exhibits a much more dramatic increase in water accessibility from ~0.12 at high pH to ~0.33 at low pH .
The limited increase in water accessibility at acidic pH suggests that NL63 E protein has a reduced capacity for pore expansion and ion conduction compared to SARS-CoV-2 E protein .
This difference in pH and calcium responsiveness likely contributes to the reduced virulence of HCoV-NL63 compared to SARS-CoV viruses, as viroporin activity has been linked to coronavirus pathogenicity .
Based on current research, several expression systems have been successfully employed for producing recombinant HCoV-NL63 E protein:
E. coli Expression System: Full-length HCoV-NL63 E protein (1-77aa) with N-terminal His-tag has been successfully expressed in E. coli . This system offers the advantages of high yield, ease of scale-up, and cost-effectiveness, though membrane proteins may require optimization of expression conditions.
Cell-Free Expression System: This system allows for in vitro expression using cell extracts containing all necessary molecules and enzymes needed for transcription, translation, and post-translational modifications . While not suitable for large-scale production, this approach enables rapid protein synthesis without cell culturing and allows for the expression of multiple proteins simultaneously.
Insect Cell Expression: For structural studies requiring proper folding and post-translational modifications, insect cell expression systems have been used for coronavirus envelope proteins, though specific data for NL63 E protein is limited.
When selecting an expression system, researchers should consider the intended application of the recombinant protein, required yield, and whether post-translational modifications are crucial for functional studies.
The purification of membrane proteins like HCoV-NL63 E protein presents unique challenges due to their hydrophobic nature. Effective purification strategies include:
Affinity Chromatography: With His-tagged constructs, immobilized metal affinity chromatography (IMAC) provides an effective initial purification step . The typical purity achieved is greater than 90% as determined by SDS-PAGE .
Detergent Solubilization: Proper selection of detergents is critical for membrane protein extraction and maintaining protein stability during purification. For NL63 E protein, detergents that preserve the native α-helical conformation should be selected.
Size Exclusion Chromatography: This technique can be used as a polishing step to separate oligomeric forms and remove aggregates while exchanging the protein into the final buffer system.
Buffer Optimization: For storage, Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been shown to maintain stability . Adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .
Several complementary spectroscopic techniques have proven valuable for characterizing the structure of HCoV-NL63 E protein:
Magic-Angle-Spinning NMR Spectroscopy: This technique has been successfully employed to measure ¹³C and ¹⁵N chemical shifts of the transmembrane domain, yielding backbone (φ, ψ) torsion angles and revealing the α-helical conformation of the protein . Both two-dimensional (2D ¹³C-¹³C, ¹⁵N-¹³C) and three-dimensional correlation spectra have been utilized.
Water-Edited 2D CC Spectra: This specialized NMR technique measures water accessibility of the protein, providing insights into pore formation and channel activity under different pH conditions . By comparing water-transferred intensities at neutral versus acidic pH, researchers can assess conformational changes related to channel function.
Solid-State NMR Spectroscopy: For determining oligomeric states and transmembrane domain organization, solid-state NMR provides valuable structural information about membrane-embedded proteins like E protein .
Circular Dichroism (CD) Spectroscopy: While not explicitly mentioned in the sources for NL63 E protein, CD spectroscopy is commonly used to assess secondary structure content and stability of membrane proteins under various conditions.
The oligomeric state of viroporins like E protein is crucial for their ion channel function. Methods to determine oligomerization include:
Crosslinking Studies: Chemical crosslinking followed by SDS-PAGE analysis can capture oligomeric species in membrane environments.
Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): This technique provides information about the molecular weight of protein-detergent complexes, helping to determine the oligomeric state.
Analytical Ultracentrifugation: This can be used to analyze the sedimentation behavior of membrane proteins in detergent solutions, providing information about molecular weight and oligomeric state.
Transmission Electron Microscopy (TEM): Negative staining TEM can visualize the ultrastructure of protein complexes in membrane environments.
Research on other coronavirus E proteins has shown that oligomeric states can vary depending on the presence of the ectodomain and experimental conditions . For instance, SARS-CoV-2 E protein has been observed as both pentamers and dimers in lipid bilayers . Similar studies with NL63 E protein would be valuable for comparing oligomerization patterns between alpha and beta coronaviruses.
The ion channel activity of HCoV-NL63 E protein shows distinct pH responsiveness that differs from other coronavirus E proteins:
Limited pH Response: Unlike SARS-CoV-2 E protein, NL63 E protein shows only modest changes in water accessibility and presumed channel activity when pH is lowered . This is likely due to structural differences in key motifs such as the 7DDN9 motif versus the 7EET9 motif in SARS-CoV-2 .
Measurement Methods:
Water-Edited NMR Spectroscopy: This technique can measure changes in water accessibility at different pH values, providing indirect evidence of channel formation .
Electrophysiology: Patch-clamp recordings or planar lipid bilayer experiments can directly measure ion conductance of reconstituted E protein channels under varying pH conditions.
Fluorescence-Based Assays: Liposomes loaded with pH-sensitive or ion-sensitive fluorescent dyes can be used to monitor ion flux through E protein channels in response to pH changes.
Experimental Considerations: When studying pH effects, it's important to use experimental conditions that mimic the ERGIC compartment, where E protein is naturally located. This includes appropriate pH ranges (acidic) and physiologically relevant Ca²⁺ concentrations .
The E protein of HCoV-NL63, like other coronavirus E proteins, plays multiple crucial roles in the viral lifecycle:
Viral Assembly: The E protein is abundantly expressed inside infected cells during replication, with the majority localized to intracellular trafficking sites such as the ER, Golgi, and ERGIC, where it aids in viral assembly and budding .
Virion Formation: Only a small fraction of the expressed E protein is integrated into the virion membrane , but this incorporation is essential for proper virion morphology.
Viral Production and Maturation: The E protein plays an important role in viral production and maturation . Absence or inactivation of E protein leads to attenuated viruses due to changes in either virion morphology or tropism .
Pathogenesis Mechanisms: The viroporin activity of E protein contributes to viral pathogenicity . The reduced ion channel activity of NL63 E protein compared to SARS-CoV E protein may partially explain the lower pathogenicity of HCoV-NL63 .
Attachment to Host Cells: While the spike (S) protein is primarily responsible for receptor binding, research has shown that in HCoV-NL63, a concerted action of membrane (M) and spike (S) proteins is required for effective infection .
HCoV-NL63 offers several advantages as a model system for coronavirus research:
Shared Receptor with SARS-like Coronaviruses: HCoV-NL63 uses the same receptor (ACE2) as SARS-CoV and SARS-CoV-2 for cellular entry . This makes it valuable for comparative studies of receptor dynamics and viral entry mechanisms.
Lower Biosafety Requirements: While SARS-like coronaviruses require BSL-3 facilities, HCoV-NL63 research can be performed in BSL-2 laboratories , making it more accessible for basic research.
Natural Disease Model: HCoV-NL63 causes upper and lower respiratory tract infections primarily in young children , providing a natural disease model that is less severe than SARS or COVID-19.
Structural Insights: Structural differences between NL63 E protein and SARS-CoV-2 E protein, such as the arrangement of phenylalanine residues and polar motifs, may explain differences in ion channel activity and pathogenicity . These insights could guide the development of antivirals targeting E protein viroporin activity.
Therapeutic Development: The data from HCoV-NL63 E protein research "may be important for future research into vaccine or drug development" . Understanding the structural basis of reduced pathogenicity in HCoV-NL63 could inform strategies to attenuate more dangerous coronaviruses.
Several methodologies can be employed to study E protein-host protein interactions:
Co-Immunoprecipitation (Co-IP): This classical approach can identify protein-protein interactions between E protein and host factors. Antibodies against the E protein or epitope tags can be used to pull down protein complexes from cell lysates.
Proximity-Based Labeling: Techniques like BioID or APEX2 tagging, where the E protein is fused to a promiscuous biotin ligase, can identify proteins in close proximity to E protein in living cells.
Yeast Two-Hybrid (Y2H) Screening: This can be used to identify direct protein-protein interactions, though care must be taken with membrane proteins.
Mass Spectrometry-Based Proteomics: Quantitative proteomics approaches can identify changes in the abundance or modification state of host proteins in response to E protein expression.
Fluorescence Microscopy: Colocalization studies using fluorescently-tagged E protein and cellular markers can reveal subcellular localization and trafficking patterns.
Structural Studies: As demonstrated with SARS-CoV-2 E protein, structural techniques can reveal interactions with host proteins. For example, cryo-electron microscopy has shown how the SARS-CoV-2 E protein's PDZ-binding motif interacts with host PALS1 . Similar approaches could be applied to HCoV-NL63 E protein.
While specific data on HCoV-NL63 E protein mutations is limited in the provided sources, general principles and approaches for studying mutational effects include:
In Silico Analysis: Computational approaches can predict how mutations might affect protein structure, stability, and function. For example, analyzing the conservation of key residues across clinical isolates can provide insights into evolutionary constraints .
Site-Directed Mutagenesis: Targeted mutations of key residues in the E protein can be introduced to assess their impact on:
Transmembrane domain stability and conformation
Ion channel activity
Protein-protein interactions
Viral assembly and budding
Key Regions for Mutation Studies:
Functional Assays: Following mutagenesis, changes in ion channel activity, protein trafficking, or virus assembly can be assessed using appropriate biochemical and cellular assays.
Understanding how specific mutations affect HCoV-NL63 E protein function could provide insights into the molecular determinants of coronavirus pathogenicity and identify potential targets for antiviral interventions.
For functional studies of HCoV-NL63 E protein channels, membrane reconstitution systems must be carefully designed:
Lipid Composition: Previous studies have used POPX/cholesterol membranes for reconstitution of NL63 ETM . The lipid composition should ideally mimic the ERGIC compartment where E protein naturally resides.
Optimization Parameters:
Protein-to-lipid ratio: This should be optimized to achieve functionally relevant oligomerization without protein aggregation
pH conditions: Given the differential response to pH, experiments should test a range of pH values (typically 4.5-7.4)
Calcium concentration: Ca²⁺ ions influence channel activity and should be included at physiologically relevant concentrations
Reconstitution Methods:
Detergent dialysis: For controlled incorporation of E protein into preformed liposomes
Direct incorporation: During liposome formation when studying co-reconstitution with other viral proteins
Functional Assessment:
Research has revealed complex interactions between HCoV-NL63 structural proteins during viral entry:
Dual Protein Requirement: While it was generally accepted that the S protein is responsible for viral interaction with cellular receptors, recent studies show that "the M protein is also an important player during early stages of HCoV-NL63 infection and that the concerted action of the two proteins (M and S) is a prerequisite for effective infection" .
M Protein Role in Attachment: The M protein of HCoV-NL63 mediates attachment to heparan sulfate proteoglycans (HSPGs), which serve as initial attachment factors facilitating viral entry .
Viruslike Particle (VLP) Studies: Research using VLPs lacking the S protein demonstrated that binding to the cell is not entirely S protein dependent . VLPs composed of M, E, N, and optionally S proteins have been produced to study these interactions .
Receptor Binding Dynamics: After initial attachment, the S protein of HCoV-NL63 engages with ACE2, the same receptor used by SARS-CoV and SARS-CoV-2 . The receptor binding domain (RBD) of HCoV-NL63 is located at the C-terminal region of the S1 subunit .
Evolutionary Insights: Despite sharing ACE2 as a receptor with SARS-CoV viruses, HCoV-NL63 lacks structural homology in the RBD region . This suggests convergent evolution of receptor usage through different structural solutions.
This understanding of the coordinated action of multiple viral proteins "broadens the understanding of HCoV-NL63 biology and may also alter the way in which we perceive the first steps of cell infection with the virus" .
Understanding the dynamic behavior of E protein requires specialized techniques that can capture conformational changes under various conditions:
Time-Resolved Structural Methods:
Temperature-jump NMR: To monitor conformational changes in response to rapid changes in environmental conditions
Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map regions of E protein that undergo conformational changes in response to pH or calcium
Single-molecule FRET: To monitor distance changes between labeled positions during channel opening and closing
Molecular Dynamics Simulations:
All-atom molecular dynamics can provide insights into the conformational flexibility of E protein in lipid bilayers
Simulations can test hypotheses about how the 7DDN9 motif and phenylalanine arrangement influence channel dynamics
Cryo-Electron Microscopy:
Single-particle cryo-EM could potentially capture different conformational states of E protein channels
Sample preparation at different pH values could reveal structural changes related to channel activation
Functional Correlation Studies:
Combining structural measurements with functional assays (ion conductance) to establish structure-function relationships
Correlating water accessibility measurements by NMR with ion conductance measured by electrophysiology
These approaches could help explain why "NL63 ETM has distinct structural responses to pH and calcium from SARS-CoV-2 ETM" and provide a mechanistic understanding of how these differences contribute to the reduced pathogenicity of HCoV-NL63.
HCoV-NL63 E protein presents several opportunities for antiviral development:
Viroporin Inhibitors: The ion channel activity of coronavirus E proteins represents a potential drug target. Understanding the structural basis of HCoV-NL63 E protein channel formation could guide the development of small-molecule inhibitors that block this function.
Comparative Drug Screening: As noted in recent research, "E protein may adopt different oligomeric states, and depending on that the binding of antivirals may be affected" . Screening drug candidates against both HCoV-NL63 E protein and SARS-CoV-2 E protein could identify compounds with broad-spectrum activity.
Attenuated Vaccine Development: Knowledge of the E protein's role in viral pathogenicity could inform strategies to create attenuated coronavirus vaccines. Specific mutations in the E protein could reduce virulence while maintaining immunogenicity.
Peptide-Based Inhibitors: Peptides derived from regions of the E protein involved in protein-protein interactions could potentially disrupt viral assembly and maturation.
Structure-Based Drug Design: The solved structure of HCoV-NL63 E protein provides a template for in silico screening of compounds that may interfere with its function. The differences in channel-forming regions between HCoV-NL63 and SARS-CoV-2 E proteins could be exploited to design selective inhibitors.
Research findings on HCoV-NL63 E protein "may be important for future research into vaccine or drug development" , particularly in creating broad-spectrum antivirals against multiple coronaviruses.
To investigate the immunomodulatory functions of HCoV-NL63 E protein:
Cytokine Profiling: Measure changes in cytokine/chemokine expression in cell culture models expressing wild-type versus mutant E protein to identify specific immune pathways affected.
Inflammasome Activation Studies: Assess whether HCoV-NL63 E protein activates or suppresses NLRP3 inflammasome components, as has been shown for other coronavirus E proteins.
Signaling Pathway Analysis: Use phosphoproteomics and transcriptomics to map cellular signaling pathways affected by E protein expression, focusing on innate immune response pathways.
Protein-Protein Interaction Mapping: Identify host immune proteins that interact with E protein using immunoprecipitation combined with mass spectrometry.
Comparative Studies: Compare immune responses to HCoV-NL63 versus SARS-CoV-2, focusing on the contribution of E protein to observed differences in inflammatory responses.
Tissue-Specific Effects: Examine E protein effects in different cell types (epithelial cells, macrophages, dendritic cells) to understand tissue-specific immune modulation.