Recombinant Human coronavirus NL63 Membrane protein (M)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Viral Infection

The recombinant M protein has been instrumental in elucidating mechanisms of HCoV-NL63 attachment and entry:

Attachment to Host Cells

  • HSPG binding: Mediates initial attachment to heparan sulfate proteoglycans (HSPGs) on host cells via positively charged amino acid clusters .

  • Synergy with S protein: Works cooperatively with the spike (S) protein to enable effective infection, as shown in viruslike particle (VLP) studies .

Role in Virion Assembly

  • VLP formation: Recombinant M protein self-assembles into VLPs when co-expressed with envelope (E) and nucleocapsid (N) proteins in insect cells .

  • Interactions: Forms homodimers and interacts with N and S proteins to stabilize the viral envelope .

Experimental Validation of M Protein Function

  • Pseudoneutralization assays: Anti-M antibodies targeting residues 181–195 and 211–226 reduced VLP and live virus adhesion to cells by 70–90% .

  • HSPG competition: Soluble heparin inhibited recombinant M-mediated binding, confirming HSPG dependency .

Table 2: Critical Studies on Recombinant M Protein

Study FocusMethodologyOutcomeSource
HSPG bindingPeptide array overlayIdentified three heparin-binding regions
VLP adhesionConfocal microscopyS-protein-independent cell attachment
Antibody neutralizationPolyclonal anti-M serumBlocked viral adhesion to LLC-Mk2 cells

Applications in Vaccine and Therapeutic Development

  • Antiviral targets: The HSPG-binding regions of M protein are potential targets for inhibitors disrupting viral attachment .

  • Vaccine design: Recombinant M protein could serve as an antigen to induce neutralizing antibodies, given its surface-exposed epitopes .

Product Specs

Buffer
The default storage buffer is Tris/PBS-based buffer containing 5%-50% glycerol for liquid delivery forms. For lyophilized powder, the buffer used before lyophilization is Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare your order according to your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Datasheet & Coa
Please contact us to get it.
Expression Region
1-226aa
Mol. Weight
28.7kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Human coronavirus NL63 (HCoV-NL63)
Target Names
M
Target Protein Sequence
MSNSSVPLLEVYVHLRNWNFSWNLILTLFIVVLQYGHYKYSRLLYGLKMSVLWCLWPLVLALSIFDCFVNFNVDWVFFGFSILMSIITLCLWVMYFVNSFRLWRRVKTFWAFNPETNAIISLQVYGHNYYLPVMAAPTGVTLTLLSGVLLVDGHKIATRVQVGQLPKYVIVATPSTTIVCDRVGRSVNETSQTGWAFYVRAKHGDFSGVASQEGVLSEREKLLHLI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This protein is a component of the viral envelope and plays a crucial role in virus morphogenesis and assembly through its interactions with other viral proteins.
Database Links

KEGG: vg:2943503

Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the HCoV-NL63 M protein and what is its role in viral structure?

The membrane (M) protein of HCoV-NL63 is one of the four major structural proteins of the virus, alongside the spike (S), envelope (E), and nucleocapsid (N) proteins. The M protein is a membrane-associated protein that plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M . Unlike most coronaviruses where only the S protein is responsible for host cell binding, HCoV-NL63 M protein also participates in viral attachment to cell surfaces .

The M protein has multiple transmembrane domains and adopts an "exo-C" topology, where the C-terminal domain is exposed on the virion surface. This topological arrangement is consistent with other alphacoronaviruses such as TGEV (Transmissible Gastroenteritis Virus) .

What is the genomic organization of HCoV-NL63 and where is the M protein encoded?

The HCoV-NL63 genome consists of a large positive-strand RNA that follows the typical coronavirus genome organization: 5′-Untranslated Region (UTR)-ORF1ab-Spike (S)-ORF3-Envelope (E)-Membrane (M)-Nucleocapsid (N)-Poly(A) tail-3′ . The M protein gene is located between the E and N genes in the 3′ terminal region that encodes the structural proteins .

The viral genome produces at least six distinct mRNAs, including the full-length genomic RNA and five subgenomic mRNAs. These mRNAs are generated through a discontinuous replication strategy during minus-strand synthesis, and all share a common ~70 nucleotide leader sequence at their 5′ ends .

How does the M protein of HCoV-NL63 participate in viral attachment to host cells?

Research has demonstrated that the M protein of HCoV-NL63 mediates initial viral attachment to host cells by binding to heparan sulfate proteoglycans (HSPGs) on the cell surface . This represents a novel finding as traditionally, the spike (S) protein has been considered the primary mediator of coronavirus attachment to host cells.

Using virus-like particles (VLPs) lacking the S protein, researchers showed that binding to the cell surface still occurs through the M protein's interaction with HSPGs. The data suggests a two-step attachment and entry process:

  • Initial attachment: M protein binds to HSPGs on the cell surface

  • Receptor binding: S protein binds to ACE2 (angiotensin-converting enzyme 2)

This concerted action of both M and S proteins appears to be a prerequisite for effective infection by HCoV-NL63 .

What specific region of the M protein is responsible for HSPG binding?

The HSPG binding site on the HCoV-NL63 M protein has been mapped to the C-terminal region spanning amino acids 153-226, which is predicted to be exposed on the virion surface . This finding was validated through multiple experimental approaches:

  • Mapping studies using synthetic overlapping peptides covering the complete M protein identified regions potentially interacting with heparin

  • In silico analysis determined that regions spanning aa 25-51 and aa 93-119 are localized inside the virion or in transmembrane domains, pointing to the C-terminal region as the HSPG binding site

  • An in situ ELISA demonstrated that a recombinant protein containing the region from aa 153-226 binds to cellular HSPGs, and this interaction was inhibited by preincubation with soluble heparan sulfate

How can researchers experimentally verify M protein-mediated attachment to cells?

Based on the provided search results, several experimental approaches have been used to demonstrate M protein-mediated attachment to host cells:

  • Virus-like particle (VLP) studies: VLPs composed of M, E, and N proteins (without S protein) were used to demonstrate S-independent binding to cell surfaces .

  • Competition assays: Preincubation of VLPs or native virus with soluble heparan sulfate inhibited attachment to cells, confirming the role of HSPG interactions .

  • "Pseudoneutralization" assay: Antibodies raised against peptides corresponding to aa 181-195 and aa 211-226 of the M protein impaired the adhesion of both VLPs and native HCoV-NL63 to cells .

  • Recombinant protein binding studies: A recombinant protein containing the C-terminal region (aa 153-226) of the M protein was shown to bind to cells in an HSPG-dependent manner .

  • Confocal microscopy and flow cytometry: These techniques were used to visualize and quantify the binding of VLPs to cells under various conditions .

What is known about post-translational modifications of the HCoV-NL63 M protein?

The HCoV-NL63 M protein undergoes post-translational modifications, specifically N-glycosylation. Western blot analysis of the M protein from virus-infected cells showed multiple bands at slightly higher molecular weights than predicted, consistent with glycosylation . The predicted molecular mass of the M protein is approximately 26 kDa before modifications .

When expressed with an N-terminal FLAG epitope tag, only a single band corresponding to the unglycosylated form was observed, suggesting that the N-terminal tag might interfere with glycosylation at the predicted N-glycosylation site at position 16 .

How does the M protein interact with other viral proteins during virion assembly?

The M protein plays a critical role in coronavirus assembly through interactions with other viral components:

  • Interaction with N protein: Colocalization studies have shown that the M and N proteins form complexes within producer cells, which is important for ribonucleocapsid formation .

  • Interaction with E protein: The M and E proteins are known to colocalize in the ERGIC (Endoplasmic Reticulum-Golgi Intermediate Compartment), and their interaction is crucial for the formation of virus-like particles .

  • Interaction with viral genome: The M protein interacts with the viral genome during packaging into virions .

Immunostaining and confocal microscopy have been used to demonstrate the colocalization of the M protein with other viral proteins in the secretory pathway, particularly in the ERGIC and Golgi apparatus .

What expression systems can be used to produce recombinant HCoV-NL63 M protein?

Based on the search results, several expression systems have been used to produce recombinant HCoV-NL63 M protein:

  • Bacterial expression (E. coli): Used for producing specific domains of the M protein, such as the C-terminal region (aa 153-226) for binding studies .

  • Insect cell expression system: Baculovirus-infected insect cells have been used to produce virus-like particles containing the M protein along with other structural proteins .

  • Mammalian cell expression: Plasmid-based expression in mammalian cells such as HEK-293T and Huh-7 cells has been used for colocalization studies with other viral proteins .

When selecting an expression system, researchers should consider the intended application, as each system has advantages and limitations for structural or functional studies.

How can researchers design and produce virus-like particles (VLPs) containing the HCoV-NL63 M protein?

The search results describe a methodology for producing HCoV-NL63 VLPs in insect cells :

  • Construct design: Generate bicistronic recombinant baculovirus (rBV) coding for M and E proteins (M+E) and monocistronic N rBV (and optionally monocistronic S rBV).

  • Co-infection: Infect insect cells with these recombinant baculoviruses to express multiple viral proteins simultaneously.

  • Verification of expression: Use immunostaining and confocal microscopy to confirm protein expression and colocalization.

  • VLP purification: Harvest culture medium from infected cells and purify VLPs using appropriate techniques such as ultracentrifugation or chromatography.

  • Validation: Confirm VLP formation by Western blotting and electron microscopy.

This approach allows for the production of different VLP compositions (MEN or MENS) to study the roles of individual viral proteins in attachment and entry processes .

Why is the HCoV-NL63 M protein an attractive target for antiviral development?

The M protein of HCoV-NL63 represents an attractive target for antiviral development for several reasons:

  • Conserved structure: The M protein is well-conserved among coronaviruses, suggesting that drugs targeting this protein might have broad-spectrum activity .

  • Essential function: The M protein plays a critical role in virus assembly and, uniquely for HCoV-NL63, in viral attachment to host cells .

  • Surface exposure: The C-terminal domain involved in HSPG binding is exposed on the virion surface, making it accessible to inhibitors .

  • Precedent in betacoronaviruses: Recent research has identified a small-molecule inhibitor (JNJ-9676) targeting the M protein of betacoronaviruses, showing efficacy against SARS-CoV-2 and related viruses .

  • Complementary target: Targeting both the M protein (for attachment) and the S protein (for receptor binding) could provide more effective antiviral strategies against HCoV-NL63.

What approaches can be used to develop inhibitors targeting the HCoV-NL63 M protein?

Based on the information in the search results and recent advances in coronavirus research, several approaches could be employed to develop inhibitors targeting the HCoV-NL63 M protein:

  • Structure-based drug design: Determining the crystal structure of the M protein, particularly the HSPG-binding domain, could guide the design of small-molecule inhibitors. This approach has been successful with the M protein of betacoronaviruses .

  • Heparin/HSPG mimetics: Since the M protein binds to HSPGs, synthetic heparin-like molecules could potentially inhibit this interaction and prevent viral attachment.

  • Peptide inhibitors: Peptides derived from the HSPG-binding region (aa 153-226) could be developed as competitive inhibitors of M protein-HSPG interactions.

  • Antibody-based approaches: Polyclonal antibodies against the C-terminal domain of the M protein have shown efficacy in blocking viral attachment , suggesting that monoclonal antibodies targeting this region could be developed as therapeutics.

  • High-throughput screening: Screening chemical libraries for compounds that bind to the M protein and disrupt its functions in attachment or assembly.

How does the M protein of HCoV-NL63 compare to M proteins of other human coronaviruses?

While specific comparative data on M proteins across all human coronaviruses is limited in the search results, some important distinctions can be noted:

  • Role in attachment: The M protein of HCoV-NL63 has a unique role in mediating attachment to HSPGs, which has not been prominently described for other human coronavirus M proteins .

  • Sequence conservation: Nucleic acid sequence alignments with homologous genes of other coronaviruses from alpha, beta, and gamma groups yield nucleotide identities between 30.3% and 51.9% .

  • Structural similarity: The HCoV-NL63 M protein shows highest levels of similarity (62%) and identity (43%) with the M protein of hCoV-229E, another alphacoronavirus .

  • Topology: The "exo-C" topology observed in HCoV-NL63 M protein is consistent with the topology reported for the TGEV M protein, suggesting this may be a common feature among alphacoronaviruses .

  • Conservation of binding domain: The C-terminal region involved in HSPG binding appears to be conserved among clinical isolates of HCoV-NL63, suggesting this is a natural characteristic rather than a cell culture adaptation .

What can researchers learn from studying HCoV-NL63 M protein that might be applicable to SARS-CoV-2 research?

HCoV-NL63 provides several advantages as a model system for coronavirus research that could inform SARS-CoV-2 studies:

  • Shared receptor but different pathogenicity: Both HCoV-NL63 and SARS-CoV-2 use ACE2 as their cellular receptor, but HCoV-NL63 causes milder disease. Understanding these differences could unravel pathogenicity factors .

  • BSL-2 vs. BSL-3 requirements: HCoV-NL63 research can be performed in BSL-2 laboratories, while SARS-CoV-2 requires BSL-3 facilities, making HCoV-NL63 a safer surrogate for comparative studies .

  • Novel attachment mechanisms: The discovery that HCoV-NL63 M protein mediates attachment to HSPGs raises the question of whether the M proteins of other coronaviruses, including SARS-CoV-2, might have unrecognized roles in attachment .

  • Drug development insights: The identification of inhibitors targeting the M protein, such as JNJ-9676 for betacoronaviruses , suggests that similar approaches might be applicable across coronavirus genera.

  • Evolution insights: Studying the structural and functional conservation of M proteins across different coronaviruses could provide insights into viral evolution and host adaptation.

What are the most recent advances in understanding HCoV-NL63 M protein function?

The most significant recent advance documented in the search results is the discovery that the M protein of HCoV-NL63 mediates attachment to host cells by binding to heparan sulfate proteoglycans (HSPGs) . This finding, published in 2019, challenges the traditional view that coronavirus attachment is exclusively mediated by the S protein.

Other notable advances include:

  • Mapping of the HSPG-binding domain to the C-terminal region (aa 153-226) of the M protein

  • Demonstration that both M and S proteins are required for effective infection

  • Confirmation that this HSPG-binding property is not a cell culture adaptation but a natural characteristic of HCoV-NL63

What are promising future research directions for HCoV-NL63 M protein studies?

Based on the current state of knowledge, several promising research directions emerge:

  • Structural studies: Determining the three-dimensional structure of the M protein, particularly the HSPG-binding domain, could provide insights for drug design.

  • Mutagenesis studies: Systematic mutagenesis of the C-terminal domain could identify specific residues critical for HSPG binding and inform the design of targeted inhibitors.

  • Evolution tracking: Monitoring changes in the M protein sequence across HCoV-NL63 isolates over time could reveal evolutionary pressures and emerging variants with altered pathogenicity.

  • Cross-coronavirus comparative studies: Investigating whether M proteins from other coronaviruses also contribute to attachment through similar or different mechanisms.

  • M protein-targeted antivirals: Development and testing of small molecules, peptides, or antibodies targeting the M protein HSPG-binding domain.

  • Molecular dynamics simulations: Computational modeling of M protein interactions with HSPGs and other viral proteins to understand the dynamics of these interactions.

  • Effect on immune response: Investigation of how M protein binding to HSPGs affects innate immune sensing and subsequent adaptive immunity.

Table 1: Comparison of HCoV-NL63 M Protein with Other Coronavirus Structural Proteins

ProteinMolecular WeightPrimary FunctionRole in AttachmentPost-translational Modifications
M Protein~26 kDaVirion assembly, interaction with genome and other viral proteinsBinds to heparan sulfate proteoglycans (HSPGs)N-glycosylation
S Protein128-160 kDa (pre-glycosylation), 150-200 kDa (post-glycosylation)Host cell receptor binding and fusionBinds to ACE2 receptorN-glycosylation
E ProteinNot specified in search resultsIon channel activity, virion assemblyNot directly involvedNot specified in search results
N ProteinNot specified in search resultsPackages viral RNA, enhances RNA transcription and replicationNot directly involvedADP-ribosylation
ORF3 ProteinNot specified in search resultsPossibly involved in virus assembly/buddingNot directly involvedN-glycosylation

Table 2: Key Regions of HCoV-NL63 M Protein and Their Functions

Amino Acid RegionLocationFunctionExperimental Evidence
aa 1-24N-terminal domainContains glycosylation site at position 16Western blot analysis
aa 25-51Transmembrane domainNot involved in HSPG bindingPeptide binding studies, in silico analysis
aa 93-119Transmembrane domainNot involved in HSPG bindingPeptide binding studies, in silico analysis
aa 153-226C-terminal domain (exposed on virion surface)HSPG bindingIn situ ELISA, peptide mapping, antibody inhibition
aa 181-195Within C-terminal domainPart of HSPG binding regionUsed for generating inhibitory antibodies
aa 211-226Within C-terminal domainPart of HSPG binding regionUsed for generating inhibitory antibodies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.