Recombinant Human coronavirus NL63 Non-structural protein 3 (3)

Shipped with Ice Packs
In Stock

Description

To produce recombinant HCoV-NL63 Non-structural protein 3 protein, a well-established recombinant DNA technology is the key. A DNA template of Non-structural protein 3 was constructed with N-terminal 10xHis tag using the technique. Once the template was made, the recombinant HCoV-NL63 Non-structural protein 3 protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 1-225aa of the HCoV-NL63 Non-structural protein 3.

Human coronavirus NL63 non-structural protein 3 (Nsp3) is a viral protease involved in viral protein biogenesis, replication/transcription complex (RTC) formation, and regulation of host ubiquitinylation and ISGylation. Nsp3 exerts multiple roles in the viral life cycle. It can functions as a scaffold protein by interacting with itself and other proteins including viral Nsps and host proteins.

Product Specs

Description

Recombinant Human coronavirus NL63 Non-structural protein 3 (NSP3) is produced using established recombinant DNA technology. A DNA template encoding NSP3, incorporating an N-terminal 10xHis tag, is constructed. This template enables efficient production of the recombinant protein. CUSABIO employs rigorous quality control (QC) procedures to ensure high quality. The expressed region corresponds to amino acids 1-225 of the HCoV-NL63 NSP3. Human coronavirus NL63 NSP3 is a viral protease crucial for viral protein biogenesis, replication/transcription complex (RTC) formation, and regulation of host ubiquitination and ISGylation. It plays multiple roles in the viral life cycle, functioning as a scaffold protein through self-interaction and interactions with other viral NSPs and host proteins.

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion in production.
Synonyms
3; Non-structural protein 3; Protein 3; ns3; Accessory protein 3a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Human coronavirus NL63 (HCoV-NL63)
Target Names
3
Target Protein Sequence
MPFGGLFQLTLESTINKSVANLKLPPHDVTVLRDNLKPVTTLSTITAYLLVSLFVTYFAL FKPLTARGRVACFVLKLLTLFVYVPLLVLFGMYLDSFIIFSTLLFRFIHVGYYAYLYKNF SFVLFNVTKLCFVSGKCWYLEQSFYENRFAAIYGGDHYVVLGGETITFVSFDDLYVAIRG SCEKNLQLMRKVDLYNGAVIYIFAEEPVVGIVYSSQLYEDVPSIN
Uniprot No.

Target Background

Gene References Into Functions
  1. Evidence indicates that ORF3 protein is a structural, N-glycosylated protein incorporated into virions. PMID: 20078868
Database Links

KEGG: vg:2943500

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of HCoV-NL63 nsp3?

HCoV-NL63 nsp3 is a multifunctional protein that plays essential roles in viral replication and immune evasion. Structurally, nsp3 is one of the largest non-structural proteins encoded by the HCoV-NL63 genome and contains multiple functional domains, including:

  • Two papain-like protease domains (PLP1 and PLP2)

  • Acidic domain regions (upstream of PLP1)

  • Potential transmembrane regions

Functionally, nsp3 serves several critical roles:

  • Proteolytic processing of viral polyproteins

  • Deubiquitinating activity (particularly through PLP2 domain)

  • Modulation of host immune responses

  • Component of the viral replication complex

The protein is initially translated as part of larger polyproteins (pp1a and pp1ab) that undergo autocatalytic processing. Unlike SARS-CoV and MERS-CoV which contain only one PLpro domain, HCoV-NL63 nsp3 contains two distinct PLpro domains (PLP1 and PLP2) .

What expression systems are recommended for recombinant HCoV-NL63 nsp3 production?

Based on successful expression strategies for other coronavirus non-structural proteins, the following approaches are recommended:

Bacterial Expression System:

  • E. coli Rosetta(DE3) strain has shown good results for coronavirus protein expression

  • Culture in Terrific Broth (TB) medium supplemented with appropriate antibiotics

  • Induction with 1 mM IPTG at OD600 of 0.5-0.65

  • Growth temperature of 37°C with harvesting 3 hours post-induction

Expression Vector Design:

  • Include dual affinity tags (polyhistidine and GST) for flexible purification options

  • Incorporate a TEV protease cleavage site between the tag and target protein

  • Consider codon optimization for enhanced expression

The expression protocol that yielded 3.5 mg of purified SARS-CoV nsp1 per liter of culture can be adapted for HCoV-NL63 nsp3 , with appropriate modifications based on protein size and solubility characteristics.

What purification strategies are most effective for recombinant HCoV-NL63 nsp3?

A multi-step purification approach is recommended:

Step 1: Initial Clarification

  • Cell lysis via microfluidizer (15,000-18,000 psi)

  • High-speed centrifugation (97,000 g) to separate soluble and insoluble fractions

Step 2: Affinity Chromatography

  • Immobilized Metal Affinity Chromatography (IMAC) using nickel-charged resin

  • Elution with imidazole gradient (10-250 mM)

  • Optional: Glutathione affinity chromatography for dual-tagged constructs

Step 3: Tag Removal

  • Cleavage with TEV protease (overnight at 4°C)

  • Second IMAC to remove cleaved tag, uncleaved protein, and His-tagged TEV

Step 4: Size Exclusion Chromatography

  • Final polishing step to remove aggregates and achieve high purity

  • Buffer optimization for protein stability

Purification Efficiency Table:

Purification StepApproximate YieldPurity
Soluble lysate300-500 mg/L25-30%
IMAC #160-80 mg/L80%
Tag cleavage + IMAC #230-40 mg/L80-90%
Size exclusion20-25 mg/L>95%

The purification protocol should be optimized based on specific construct design and expression levels .

How can the proteolytic activity of HCoV-NL63 nsp3 PLPs be measured?

Several complementary approaches can be used to measure the proteolytic activity of HCoV-NL63 nsp3 papain-like proteases:

A. Peptide-based Assays:

  • Synthetic peptides corresponding to PLP cleavage sites can be used as substrates

  • Detection of cleavage products by HPLC, mass spectrometry, or fluorescence-based assays

  • Allows determination of kinetic parameters and substrate specificity

B. cis-Cleavage Assays:

  • Expression of polyprotein fragments containing nsp1-nsp2-nsp3 regions

  • Monitoring of autocatalytic processing by Western blot with specific antibodies

  • Critical for determining which PLP (PLP1 or PLP2) processes which cleavage site

C. trans-Cleavage Assays:

  • Purified recombinant PLPs incubated with substrate proteins/peptides

  • Analysis of cleavage products by SDS-PAGE or Western blot

  • Useful for inhibitor screening

Research has demonstrated that HCoV-NL63 PLP1 specifically processes cleavage site 1 (between nsp1/nsp2), while PLP2 processes both cleavage sites 2 and 3 (between nsp2/nsp3 and nsp3/nsp4) . These assays can be used to confirm proteolytic activity of recombinant proteins.

What is the role of HCoV-NL63 nsp3 in immune evasion?

HCoV-NL63 nsp3 contributes to immune evasion through multiple mechanisms:

Deubiquitinating Activity:

  • PLP2 domain exhibits deubiquitinating enzyme (DUB) activity

  • Hydrolyzes K48-linked ubiquitin chains to produce monoubiquitin

  • Forms PLP2-Ub adducts with ubiquitin-vinylsulfone inhibitors

Modulation of p53 Pathway:

  • Ectopic expression of HCoV-NL63 PLP2 induces proteasomal degradation of p53

  • Inhibits p53-dependent production of type I interferon

  • Suppresses innate immune responses

Interference with Host Protein Synthesis:

  • Contributes to suppression of host protein synthesis

  • Inhibits interferon (IFN) response pathways

Research has shown that these immune evasion mechanisms are conserved across coronaviruses but may vary in their specific targets and efficiency. The dual proteolytic and deubiquitinating activities of nsp3 make it a multifunctional tool for viral immune evasion .

How do the PLP1 and PLP2 domains in HCoV-NL63 nsp3 differ in substrate specificity and function?

HCoV-NL63 PLP1 and PLP2 domains exhibit distinct substrate specificities and functional roles:

Substrate Specificity:

  • PLP1: Specifically processes the cleavage site between nsp1 and nsp2 (cleavage site 1)

  • PLP2: Processes both cleavage sites 2 (between nsp2 and nsp3) and 3 (between nsp3 and nsp4)

Functional Importance:

  • PLP1: Dispensable for viral replication in cell culture

  • PLP2: Essential for viral replication; deletion is lethal for HCoV-NL63

Enzymatic Activities:

  • PLP1: Primarily proteolytic

  • PLP2: Both proteolytic and deubiquitinating activities; can hydrolyze K48-linked hexa-ubiquitin to produce monoubiquitin

Immune Modulation:

  • PLP2: Induces proteasomal degradation of p53, inhibiting p53-dependent production of type I IFN

These differences in substrate specificity and function between PLP1 and PLP2 are important considerations for drug development efforts targeting nsp3 . Mutagenesis studies of the catalytic residues in both domains can provide further insights into their specific roles in viral replication and pathogenesis.

What approaches can be used to characterize the deubiquitinating activity of HCoV-NL63 nsp3?

The deubiquitinating (DUB) activity of HCoV-NL63 nsp3, particularly its PLP2 domain, can be characterized using multiple complementary approaches:

A. Biochemical Assays with Purified Components:

  • Ubiquitin Chain Hydrolysis: Incubation of purified PLP2 with K48-linked hexa-ubiquitin (K48-Ub₆) substrates

  • Detection Methods: Western blot analysis using anti-ubiquitin antibodies to monitor conversion to mono-ubiquitin

  • Activity Inhibition: Use of ubiquitin-vinylsulfone (Ub-VS) inhibitor, specific for DUBs, to form PLP2-Ub adducts

B. Cellular Assays:

  • Ubiquitinated Protein Accumulation: Monitor levels of ubiquitinated proteins in cells expressing wild-type versus catalytically inactive PLP2

  • Reporter Assays: Use of ubiquitin-fusion degradation reporters to measure DUB activity in cells

C. Structural Analysis:

  • Molecular Modeling: Computational prediction of ubiquitin binding sites on PLP2

  • Co-crystallization: Structural determination of PLP2 in complex with ubiquitin or ubiquitin-like modifiers

D. Specificity Profiling:

  • Testing activity against different ubiquitin chain types (K48, K63, linear, etc.)

  • Evaluation of activity against ubiquitin-like modifiers (ISG15, SUMO, etc.)

Research has demonstrated that HCoV-NL63 PLP2, like SARS-CoV PLpro, exhibits DUB activity by hydrolysis of K48-Ub₆ to produce monoubiquitin and can be detected using Ub-VS inhibitor specific for DUBs .

How does HCoV-NL63 nsp3 interact with the viral replication complex?

HCoV-NL63 nsp3 serves as an integral component of the viral replication-transcription complex (RTC). Its interactions and functions within this complex can be studied through:

Subcellular Localization Studies:

  • Immunofluorescence microscopy to determine colocalization with other viral replication components

  • Fractionation studies to identify membrane association patterns

  • Live-cell imaging to track dynamics during infection

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation of nsp3 with other viral and cellular proteins

  • Proximity labeling techniques (BioID, APEX) to identify interaction partners

  • Yeast two-hybrid or mammalian two-hybrid screens

Functional Studies:

  • siRNA knockdown or CRISPR interference of host factors that interact with nsp3

  • Mutagenesis of key interaction domains within nsp3

  • Reconstitution assays with purified components

Structural Characterization:

  • Cryo-electron microscopy of replication complexes

  • Cross-linking mass spectrometry to identify interaction interfaces

While direct evidence for HCoV-NL63 nsp3 interactions is limited in the search results, studies of other coronaviruses indicate that nsp3 likely plays roles in:

  • Anchoring the replication complex to modified host membranes

  • Recruiting other viral and host factors to replication sites

  • Contributing enzymatic activities essential for viral RNA synthesis

What structural or functional features make HCoV-NL63 nsp3 a potential target for antiviral development?

HCoV-NL63 nsp3 presents several promising features that make it an attractive target for antiviral development:

Enzymatic Activities:

  • Papain-like proteases (PLPs): Essential for viral polyprotein processing

  • Deubiquitinating activity: Contributes to immune evasion

  • Both activities rely on well-defined catalytic sites suitable for inhibitor design

Conservation across Coronaviruses:

  • Conserved function despite sequence variation

  • Potential for broad-spectrum antivirals targeting multiple coronaviruses

  • Similar enzymatic mechanisms across coronavirus species

Essential Role in Viral Life Cycle:

  • PLP2 activity is indispensable for viral replication

  • No functional redundancy for certain nsp3 activities

  • Inhibition would block an early step in viral replication

Distinct from Host Enzymes:

  • Viral proteases recognize specific cleavage sequences

  • Structural differences from human deubiquitinating enzymes

  • Opportunity for selective targeting

Established Precedent:

  • Protease inhibitors are clinically successful for other viruses (HIV, HCV)

  • Crystal structures of coronavirus proteases provide templates for structure-based drug design

  • Several inhibitor scaffolds already identified for coronavirus PLPs

Researchers can leverage the conservation of PLpro across coronavirus species, as seen with inhibitors of the HCoV-NL63 main protease (M^pro^), which shares structural features with SARS-CoV and MERS-CoV M^pro^ . Similar approaches could target the PLpro domains in nsp3.

How can genetic diversity in HCoV-NL63 nsp3 be assessed for antiviral development?

Evaluating genetic diversity of HCoV-NL63 nsp3 is crucial for developing antivirals with broad coverage and reduced susceptibility to resistance. Key approaches include:

Sequence Analysis of Clinical Isolates:

  • Collect nsp3 sequences from diverse geographical regions and time periods

  • Identify conserved regions as potential drug targets

  • Map naturally occurring polymorphisms

Conservation Mapping onto Structural Models:

  • Generate homology models of HCoV-NL63 nsp3 domains

  • Map sequence conservation onto structural features

  • Identify conserved catalytic sites and substrate-binding pockets

Phylogenetic Analysis:

  • Construct phylogenetic trees of nsp3 sequences

  • Compare evolutionary patterns with other coronaviruses

  • Identify selective pressures on specific domains

Recombination Analysis:

  • Detect evidence of recombination events in nsp3

  • Evaluate impact on functional domains

  • Assess implications for drug resistance

Functional Impact Assessment:

  • Express variant forms of nsp3 domains to evaluate functional differences

  • Test inhibitor efficacy against diverse nsp3 variants

  • Identify resistance mutations through in vitro selection

What in vitro systems are available for studying HCoV-NL63 nsp3 in a cellular context?

Several in vitro systems can be employed to study HCoV-NL63 nsp3 in a cellular context:

Cell Lines Supporting HCoV-NL63 Replication:

  • LLC-MK2 (rhesus monkey kidney epithelial cells)

  • Huh-7 (human hepatocellular carcinoma cells)

  • CaCo-2 (human colorectal adenocarcinoma cells)

Expression Systems:

  • Transient Transfection: Plasmid-based expression of nsp3 or specific domains

  • Stable Cell Lines: Creation of inducible nsp3-expressing cell lines

  • Viral Replicon Systems: Modified viral genomes expressing reporter proteins

Cellular Assays:

  • Immunofluorescence Microscopy: Detection of nsp3 in HCoV-NL63-infected cells using specific antibodies

  • Western Blot Analysis: Monitoring nsp3 expression and processing in infected cells

  • Co-Localization Studies: Analysis of nsp3 with markers for subcellular compartments

K18-hACE2 Mouse Model:

  • Transgenic mice expressing human ACE2 receptor

  • Supportive of HCoV-NL63 replication

  • Detection of nsp3 in infected lung tissues

  • Useful for in vivo validation of findings from cell culture

Research has shown that HCoV-NL63 nsp3 can be detected in virus-infected cells at 24 hours post-infection and accumulates in perinuclear sites . These systems allow for the study of nsp3 expression, localization, processing, and function within the context of the full viral life cycle.

What techniques can be used to study the interaction between HCoV-NL63 nsp3 and host cellular proteins?

Multiple complementary techniques can be employed to investigate interactions between HCoV-NL63 nsp3 and host cellular proteins:

Affinity Purification-Mass Spectrometry (AP-MS):

  • Expression of tagged nsp3 (or domains) in human cells

  • Affinity purification of protein complexes

  • Identification of interacting partners by mass spectrometry

  • Quantitative comparison between wild-type and mutant forms

Proximity-Based Labeling:

  • Fusion of BioID or APEX2 to nsp3

  • Biotinylation of proximal proteins in living cells

  • Streptavidin pulldown and mass spectrometry identification

  • Spatial mapping of protein interactions

Co-Immunoprecipitation (Co-IP):

  • Antibody-based pulldown of nsp3 followed by Western blot

  • Validation of specific interactions identified by global approaches

  • Analysis in both overexpression and infection contexts

Protein Complementation Assays:

  • Split luciferase or fluorescent protein assays

  • Mammalian two-hybrid systems

  • FRET/BRET-based interaction monitoring

Computational Predictions:

  • Interface prediction based on structural models

  • Molecular docking simulations

  • Analysis of sequence motifs mediating protein-protein interactions

Research has indicated that HCoV-NL63 PLP2 interacts with and modulates p53, leading to inhibition of type I interferon responses . Further studies using these techniques could reveal additional host pathways targeted by nsp3 during infection.

How can crystal structures of HCoV-NL63 nsp3 domains be obtained for structure-based drug design?

Obtaining crystal structures of HCoV-NL63 nsp3 domains involves several key steps and considerations:

Domain Identification and Construct Design:

  • Perform bioinformatic analysis to identify domain boundaries

  • Design multiple constructs with varying N- and C-terminal boundaries

  • Include or exclude flexible regions based on disorder predictions

  • Consider fusion tags that enhance solubility (e.g., MBP, SUMO)

Protein Expression Optimization:

  • Test multiple expression systems (bacterial, insect cell, mammalian)

  • Optimize induction conditions (temperature, time, inducer concentration)

  • Screen for solubility and stability of expressed proteins

  • Consider codon optimization for the expression host

Purification Strategy:

  • Implement multi-step purification (affinity, ion exchange, size exclusion)

  • Include tag removal step when appropriate

  • Monitor protein homogeneity by dynamic light scattering

  • Verify proper folding by circular dichroism spectroscopy

Crystallization:

  • Concentrate protein to 5-20 mg/mL (domain-dependent)

  • Screen numerous crystallization conditions (sparse matrix approach)

  • Optimize promising conditions by varying pH, salt, precipitant concentrations

  • Consider crystallization with ligands, inhibitors, or substrate analogs

Structure Determination:

  • Collect X-ray diffraction data at synchrotron radiation facilities

  • Solve structure by molecular replacement using homologous structures

  • Perform model building and refinement

Alternative Approaches if Crystallization Fails:

A similar approach was successful for solving the crystal structure of HCoV-NL63 nucleocapsid protein domains at 1.5 Å resolution , and could be applied to nsp3 domains.

What are the current challenges in developing specific inhibitors for HCoV-NL63 nsp3?

Developing specific inhibitors for HCoV-NL63 nsp3 faces several significant challenges:

Structural Complexity:

  • Multi-domain nature of nsp3 complicates structural characterization

  • Limited structural data available compared to other viral targets

  • Multiple enzymatic activities requiring different inhibitor approaches

Selectivity Considerations:

  • Need to distinguish between coronavirus PLPs and human deubiquitinating enzymes

  • Challenge of achieving specificity while maintaining broad coronavirus coverage

  • Potential off-target effects on host proteases and DUBs

Assay Development:

  • Complexity of establishing high-throughput screening assays for PLP activity

  • Need for cellular assays that reflect physiological conditions

  • Difficulty in developing assays that distinguish between protease and DUB activities

Drug Delivery:

  • Targeting proteins in membrane-associated replication complexes

  • Achieving sufficient cellular penetration of inhibitors

  • Potential issues with compound stability and bioavailability

Resistance Development:

  • Natural variation in nsp3 sequences across HCoV-NL63 isolates

  • Potential for rapid emergence of resistance mutations

  • Need to target highly conserved regions or multiple sites simultaneously

Validation Challenges:

  • Limited animal models for HCoV-NL63 infection

  • Difficulty in attributing antiviral effects specifically to nsp3 inhibition

  • Need to establish clear structure-activity relationships

Progress in this area could build on approaches used for other coronavirus proteases, such as the work on HCoV-NL63 M^pro^ inhibitors that demonstrated the feasibility of developing compounds with activity against multiple coronavirus species .

How can the role of HCoV-NL63 nsp3 in viral pathogenesis be studied in animal models?

Studying the role of HCoV-NL63 nsp3 in viral pathogenesis requires specialized animal models and experimental approaches:

K18-hACE2 Transgenic Mouse Model:

  • Expresses human ACE2 receptor required for HCoV-NL63 entry

  • Supports viral replication as evidenced by:

    • Increased viral RNA levels 3-4 days post-infection

    • Detection of nsp3 protein by immunoblot and immunofluorescence

    • Induction of IFNα1 mRNA expression

    • Development of airway inflammation

Experimental Design:

  • Infection Protocol:

    • Intranasal inoculation with 1×10^5^ TCID50 HCoV-NL63

    • Time course analysis (0-6 days post-infection)

    • Comparison with wild-type C57BL/6J mice as control

  • Pathogenesis Assessment:

    • Viral load quantification by qPCR and conventional PCR

    • Protein detection via immunoblotting and immunofluorescence

    • Histopathological analysis of lung tissues

    • Bronchoalveolar lavage (BAL) cell counts

    • Cytokine/chemokine profiling

    • Airway hyperresponsiveness measurements

  • Targeted nsp3 Studies:

    • Engineering of recombinant viruses with mutations in nsp3 domains

    • Comparison of wild-type vs. mutant virus pathogenesis

    • Evaluation of specific function (e.g., PLP activity) on disease progression

Data Analysis Approaches:

  • Statistical assessment using Kruskal-Wallis test for nonparametric data

  • Group differences pinpointed by Dunn's multiple comparisons test

  • Two-way analysis of variance for airways resistance data

  • RNA-Seq analysis for global host response profiling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.