Recombinant Human coronavirus OC43 Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HE; 2b; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-424
Protein Length
Full Length of Mature Protein
Species
Human coronavirus OC43 (HCoV-OC43)
Target Names
HE
Target Protein Sequence
FYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYNSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN NPDLPICVYDPLPVILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA
Uniprot No.

Target Background

Function

Hemagglutinin-esterase (HE) is a structural protein forming short spikes on the coronavirus surface. It exhibits receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid—a crucial receptor determinant for erythrocyte and susceptible cell recognition. This receptor-destroying activity is vital for viral release, preventing self-aggregation and promoting efficient cell-to-cell progeny virus spread. HE may also function as a secondary attachment protein in infection initiation, with the spike protein being the primary attachment protein. HE is likely a target for both humoral and cellular immune responses.

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the hemagglutinin-esterase protein of HCoV-OC43 and how does it differ from other coronavirus proteins?

The hemagglutinin-esterase (HE) protein is a characteristic feature of most betacoronaviruses, including Human coronavirus OC43 (HCoV-OC43). This protein possesses acetyl-esterase activity that removes acetyl groups from O-acetylated sialic acid, suggesting its role as a receptor-destroying enzyme . While the spike (S) protein is considered the main viral factor influencing coronavirus infection of susceptible cells, the HE protein works in conjunction with the S protein to enhance the infectious properties of HCoV-OC43 . The HE protein is believed to be the major hemagglutinin of this virus and may be involved in binding to cellular receptors, similar to the HE protein of BCoV . This multifunctional characteristic distinguishes it from other structural proteins of coronaviruses and makes it particularly important for understanding viral pathogenesis.

How does the HE protein contribute to HCoV-OC43 infection at the molecular level?

At the molecular level, the HE protein of HCoV-OC43 contributes to infection through multiple mechanisms. Research using recombinant viruses and complementation experiments has demonstrated that the HE protein plays a significant role in the production of infectious coronaviral particles . These particles can subsequently infect susceptible epithelial and neuronal cells more efficiently than viruses lacking functional HE protein .

The HE protein contains an O-acetyl-esterase active site sequence (FGDS) located between amino acid residues 37 to 40 . This enzymatic activity is critical for its function, as mutations that abolish this activity (such as changing serine at position 40 to threonine, modifying the active site to FGDT) affect the virus's ability to spread efficiently in cell culture . Mechanistically, the HE protein appears to enhance infection by interacting with O-acetylated sialic acid on host cell surfaces, potentially modifying these interactions to facilitate viral entry or release .

What experimental evidence supports the role of HE protein in coronavirus infectious properties?

Several lines of experimental evidence support the essential role of HE protein in coronavirus infectious properties. Researchers have utilized molecular clones of recombinant HCoV-OC43 with various modifications to the HE gene to investigate its function . Studies have generated different pBAC-OC43-HE mutants, including:

  • pBAC-OC43-HEstop: Contains a point mutation at nucleotide position 8 of the coding sequence, replacing the amino acid residue leucine at position 3 with a STOP codon .

  • pBAC-OC43-HE S116F: Features a mutation at nucleotide position 347 of the HE coding sequence, changing the amino acid residue at position 116 from serine to phenylalanine .

  • pBAC-OC43-HE S40T: Contains a mutation at nucleotide position 119 in the HE coding sequence, changing serine at position 40 to threonine to abolish the O-acetyl-esterase activity .

Complementation experiments using BHK-21 cells expressing wild-type HE, either transiently or in stable ectopic expression, demonstrated that this protein plays a significant role in the production of infectious recombinant coronaviral particles . These particles subsequently more efficiently infected susceptible epithelial and neuronal cells compared to viruses lacking functional HE . Additionally, neutralizing antibody studies against the HE protein have further confirmed its importance in HCoV-OC43 infection of target cells .

How do the acetyl-esterase activities of HE protein affect viral attachment and release?

The acetyl-esterase activity of the HE protein is believed to play a dual role in viral attachment and release. As a receptor-destroying enzyme, it removes acetyl groups from O-acetylated sialic acid on host cell surfaces . This enzymatic activity appears to be critical for the virus lifecycle through several mechanisms:

  • During viral attachment, the HE protein may work in conjunction with the S protein to enhance binding to O-acetylated sialic acid receptors on target cells .

  • During viral release, the acetyl-esterase activity likely helps in the detachment of progeny virions from infected cells by cleaving the O-acetyl groups on sialic acids, thereby preventing viral aggregation and facilitating efficient spread to neighboring cells .

  • The importance of this enzymatic activity is demonstrated by mutations that abolish the O-acetyl-esterase activity (such as S40T), which affect the virus's ability to spread efficiently in cell culture .

The interplay between the receptor-binding and receptor-destroying activities of HE likely contributes to the fine balance required for optimal viral infection and spread in tissues expressing different levels of O-acetylated sialic acids.

What are the current methods for producing recombinant HCoV-OC43 HE proteins for research?

Production of recombinant HCoV-OC43 HE proteins for research typically follows several methodological approaches:

  • Reverse Genetics Systems: Researchers use full-length cDNA clones (such as pBAC-OC43-FL) as templates for generating modified HE proteins. The QuikChange multisite-directed mutagenesis kit is commonly employed to introduce specific mutations into the HE gene . This approach allows for precise control over the modifications made to the protein.

  • Cell Culture Systems: For expression of recombinant HE proteins, several cell lines are utilized:

    • BHK-21 cells for transfection with recombinant viral constructs

    • Human adenocarcinoma cell line HCT-8 for virus propagation

    • Human neuroblastoma cell line LA-N-5, differentiated using all-trans retinoic acid treatment (10 μM for 6 days), for neuronal cell infection studies

  • Ectopic Expression Systems: Both transient and stable expression systems have been used to produce wild-type and mutant HE proteins in BHK-21 cells for complementation experiments . These systems help evaluate the function of HE protein variants in the context of viral infection.

  • Mutagenesis Strategies: Targeted mutations are introduced to study specific aspects of HE function, such as:

    • Insertion of STOP codons to prevent HE expression (HEstop)

    • Point mutations that affect protein structure (S116F)

    • Modifications to the enzymatic active site (S40T) to abolish O-acetyl-esterase activity

These methodologies provide complementary approaches for investigating the structure-function relationships of HCoV-OC43 HE protein in viral infection and pathogenesis.

What are the challenges in purifying active HE protein for functional studies?

Purifying active HE protein for functional studies presents several methodological challenges that researchers must address:

  • Maintaining Structural Integrity: The HE protein contains complex structural elements, including glycosylation sites and disulfide bonds that are essential for proper folding and function. Purification methods must preserve these post-translational modifications.

  • Preserving Enzymatic Activity: The acetyl-esterase activity of HE is sensitive to purification conditions. Harsh extraction methods may denature the protein or inactivate its enzymatic function. Researchers must carefully optimize buffer conditions, temperature, and purification techniques to maintain activity.

  • Expression System Selection: The choice of expression system significantly impacts protein yield and functionality. While bacterial systems offer high yield, they often fail to provide proper glycosylation. Mammalian expression systems better replicate the native viral environment but may have lower yields.

  • Protein Stability: Recombinant HE proteins may have limited stability during storage and handling. Adding stabilizing agents and optimizing storage conditions are critical considerations for maintaining functional activity for experimental use.

  • Functional Validation: After purification, researchers must confirm that the recombinant HE protein retains its biological activities. This typically involves assessing both the receptor-binding function and the acetyl-esterase activity through specific enzymatic assays.

Addressing these challenges requires an integrated approach combining careful experimental design, optimization of expression and purification protocols, and rigorous functional validation to ensure that the purified HE protein accurately represents its native characteristics.

How has the HE protein evolved across different HCoV-OC43 genotypes?

The evolution of the HE protein across different HCoV-OC43 genotypes represents a fascinating aspect of coronavirus adaptation. Molecular epidemiology studies have identified at least four distinct genotypes (A to D) of HCoV-OC43, with significant variations in their HE proteins :

  • Genotype A: Represents the most ancient lineage, dating back to the 1950s based on molecular clock analysis. Interestingly, among 29 clinical strains analyzed in one study, none belonged to this ancestral genotype , suggesting it may have been replaced by newer variants.

  • Genotype B: Emerged in the 1990s based on molecular clock analysis. In a sampling of 29 clinical strains, 5 isolates from 2004 belonged to this genotype .

  • Genotype C: Emerged in the late 1990s to early 2000s. This genotype was predominant in samples collected between 2004 and 2006, with 15 of 29 clinical strains belonging to this genotype .

  • Genotype D: Represents a recombinant lineage that arose from recombination events between genotypes B and C. This recombinant genotype was detected as early as 2004, with one strain from 2004 and all 8 strains from 2008 to 2011 belonging to genotype D .

Molecular clock analysis using spike and nucleocapsid genes dated the most recent common ancestor of all genotypes to the 1950s, with genotypes B and C emerging in the 1980s . These evolutionary patterns suggest ongoing adaptation of the HE protein, potentially in response to changing host factors or immune pressures.

What evidence supports recombination events in the evolution of HCoV-OC43 HE?

Strong evidence supports recombination events in the evolution of HCoV-OC43 HE, particularly in the emergence of genotype D. Detailed molecular analyses have revealed several key findings:

  • Phylogenetic Incongruence: Analysis of 29 HCoV-OC43 strains collected between 2004 and 2011 identified 10 unusual strains displaying incongruent phylogenetic positions between the RNA-dependent RNA polymerase (RdRp) and spike genes . This pattern of incongruence is a classic signature of recombination events.

  • Complete Genome Sequencing: Researchers performed complete genome sequencing of representative genotype C and D strains to investigate the potential recombination events in detail .

  • Bootscan Analysis: Bootscan analysis, a computational method used to detect recombination in viral genomes, provided evidence for recombination events between genotypes B and C in the generation of genotype D .

  • Temporal Emergence Pattern: The recombinant genotype D was detected as early as 2004 and became the predominant genotype in later years (2008-2011) , suggesting a selective advantage for this recombinant form.

  • Clinical Relevance: Notably, genotype D strains were associated with pneumonia in elderly patients , suggesting potential changes in virulence or tissue tropism resulting from recombination events.

This evidence collectively demonstrates that natural recombination plays a significant role in the evolution of HCoV-OC43, contributing to genetic diversity and potentially affecting viral pathogenesis and host adaptation.

What computational methods are used to analyze recombination events in coronavirus HE genes?

Several sophisticated computational methods are employed to analyze recombination events in coronavirus HE genes:

The application of these methods to HCoV-OC43 sequences has revealed important insights about recombination events, as shown in the following data:

Genotype and analysis modelStrict clockRelaxed uncorrelated clock (Log-normal)Relaxed uncorrelated clock (Exponential)
MeanHPDMeanHPD
S gene (Constant size)
A, B, and C48.155544.7545–53.544449.414
B and C27.472522.2275–33.663621.3901
N gene (Constant size)
A, B and C55.600744.102–80.159155.2781
B and C26.235313.0594–44.62524.6398

This table shows the estimated time of the most recent common ancestor (tMRCA) in years before 2011 for different HCoV-OC43 genotypes under various evolutionary models .

How can site-directed mutagenesis be optimized for studying HE protein function?

Optimizing site-directed mutagenesis for studying HE protein function requires a systematic approach with several key considerations:

  • Strategic Target Selection: Based on sequence alignments and structural predictions, researchers should identify critical residues for mutagenesis, including:

    • The O-acetyl-esterase active site (FGDS, amino acids 37-40) where serine at position 40 is crucial for enzymatic activity

    • Residues involved in receptor binding, such as position 116 where a serine to phenylalanine mutation (S116F) affects function

    • Regions potentially involved in interaction with the spike protein

  • Mutagenesis Protocol Optimization: When using systems like the QuikChange multisite-directed mutagenesis kit (Agilent-Stratagene) with pBAC-OC43-FL as template , researchers should:

    • Design primers with minimal secondary structure

    • Optimize annealing temperatures based on primer GC content

    • Adjust extension times according to template size

    • Use high-fidelity DNA polymerases to minimize unwanted mutations

  • Verification Strategies: Multiple verification steps should be implemented:

    • Sequence the entire HE gene, not just the targeted mutation site

    • Confirm protein expression by Western blot

    • Verify proper protein folding through functional assays

    • Assess O-acetyl-esterase activity using specific substrates

  • Functional Analysis Framework: Establish complementary assays to evaluate the impact of mutations:

    • Enzymatic activity assays for esterase function

    • Binding assays for receptor interaction

    • Cell infection studies to assess viral entry efficiency

    • Viral spread assays to evaluate the impact on virus dissemination

  • Control Mutations: Include both negative controls (HEstop) and mutations with predicted partial effects to establish a functional gradient for the protein.

This comprehensive approach ensures that the mutagenesis strategy provides robust insights into structure-function relationships of the HCoV-OC43 HE protein.

What are the implications of HE research for developing coronavirus antiviral strategies?

Research on the HCoV-OC43 hemagglutinin-esterase (HE) protein has significant implications for developing coronavirus antiviral strategies:

  • Novel Target Identification: The HE protein represents a potential target for antiviral development distinct from the more commonly targeted spike protein. Since studies have shown that HE enhances viral infectious properties and contributes to efficient virus dissemination , targeting this protein could provide complementary approaches to existing antiviral strategies.

  • Enzyme Inhibition Approach: The acetyl-esterase activity of HE provides a specific enzymatic function that could be targeted with small-molecule inhibitors. Compounds that block the O-acetyl-esterase active site (FGDS, amino acids 37-40) might impair viral release and spread without affecting host cell enzymes.

  • Receptor Interaction Blockade: Since HE interacts with O-acetylated sialic acid , compounds that mimic this interaction or antibodies that block this binding could potentially neutralize virus infectivity, particularly when combined with spike protein-targeted therapies.

  • Recombination-Resistant Strategies: Understanding the recombination events that lead to new genotypes, such as genotype D , helps in designing antiviral strategies that target conserved regions less likely to be affected by recombination.

  • Clinical Relevance: The association of certain genotypes (such as genotype D) with pneumonia in elderly populations highlights the importance of considering HE variation in the development of therapeutic interventions, particularly for vulnerable populations. In a study of 29 patients with HCoV-OC43 infections, 14 presented with pneumonia, with 9 being elderly patients over 60 years old :

Patient GroupNumber with PneumoniaTotal in Group
Infants/Young Children313
Adults (36-46 years)22
Elderly (>60 years)914

These findings suggest that targeting HE might be particularly important for preventing severe disease in elderly populations, who appear more susceptible to developing pneumonia from HCoV-OC43 infections.

How can neutralizing antibodies against HE be developed and characterized?

Developing and characterizing neutralizing antibodies against the HCoV-OC43 HE protein requires a systematic approach combining immunological techniques with functional assays:

  • Antigen Preparation Strategies:

    • Recombinant full-length HE protein expression in mammalian cells to maintain native conformation and glycosylation

    • Production of specific HE domains or peptides corresponding to key functional regions

    • Purification methods that preserve protein integrity and antigenic properties

    • Quality control through mass spectrometry and circular dichroism to confirm structural integrity

  • Antibody Generation Platforms:

    • Hybridoma technology for monoclonal antibody production using immunized mice or rabbits

    • Phage display libraries for selecting high-affinity antibody fragments

    • Single B-cell sorting from convalescent patients for isolation of naturally occurring neutralizing antibodies

    • Humanization of mouse-derived antibodies for potential therapeutic applications

  • Screening and Selection Methodologies:

    • ELISA-based binding assays to identify antibodies with high affinity for HE

    • Competition assays to identify antibodies targeting specific functional domains

    • Epitope mapping to characterize the binding sites of promising antibody candidates

    • Cross-reactivity testing against HE proteins from different HCoV-OC43 genotypes (A-D)

  • Functional Characterization Assays:

    • Neutralization assays using recombinant viruses expressing wild-type or mutant HE

    • Enzyme inhibition assays to assess blockade of acetyl-esterase activity

    • Cell-based infectivity assays in relevant cell types (HCT-8 epithelial cells and LA-N-5 neuronal cells)

    • Viral spread assays to evaluate the ability of antibodies to prevent cell-to-cell transmission

  • Validation in Complex Systems:

    • Ex vivo tissue cultures to assess antibody efficacy in a more physiologically relevant context

    • Potential animal model testing using transgenic mice susceptible to HCoV-OC43

    • Combinatorial testing with antibodies targeting other viral proteins (particularly spike)

This comprehensive approach would yield well-characterized neutralizing antibodies against HE with potential applications in both basic research and therapeutic development.

How do different HCoV-OC43 genotypes with varying HE proteins correlate with clinical outcomes?

The correlation between HCoV-OC43 genotypes with varying HE proteins and clinical outcomes reveals important patterns in disease presentation and severity:

  • Genotype-Specific Disease Associations: Analysis of 29 patients with HCoV-OC43 infections showed distinct clinical patterns among different viral genotypes :

    • Genotype B (5 strains from 2004): Associated with both upper respiratory tract infections (URTI) and pneumonia in diverse age groups

    • Genotype C (15 strains from 2004-2006): Predominantly associated with URTI in children and pneumonia in elderly patients

    • Genotype D (1 strain from 2004, 8 strains from 2008-2011): Associated with pneumonia in elderly patients and pneumonia in young children

  • Age-Related Clinical Presentations: The clinical impact of different genotypes appears to be modulated by patient age :

    Clinical PresentationChildren (≤18 years)Adults (19-59 years)Elderly (≥60 years)
    Upper Respiratory Tract Infection1122
    Pneumonia329
  • Complications by Genotype: More severe complications were observed in patients infected with specific genotypes :

    • Exacerbation of chronic obstructive pulmonary disease (COPD) was observed in two elderly patients infected with genotype C and one with genotype D

    • Pleural effusion was documented in patients infected with genotype C and genotype D

  • Mortality Associations: While most patients survived regardless of genotype, one 94-year-old female patient with genotype D infection died of pneumonia complicated by superimposed Pseudomonas aeruginosa infection .

  • Temporal Trends: The shift from predominantly genotype C (2004-2006) to genotype D (2008-2011) coincided with a higher proportion of pneumonia cases, suggesting potential increased virulence of the recombinant genotype D .

These findings highlight the importance of monitoring HCoV-OC43 genotypes and their HE variations in clinical settings, particularly for vulnerable populations like the elderly, who appear to be at higher risk for severe outcomes with certain viral genotypes.

What methodologies are used to track HCoV-OC43 HE evolution in population surveillance studies?

Comprehensive methodologies for tracking HCoV-OC43 HE evolution in population surveillance studies combine molecular techniques, bioinformatics approaches, and epidemiological analyses:

  • Sample Collection and Processing:

    • Systematic collection of nasopharyngeal aspirates from patients with respiratory symptoms

    • RNA extraction using validated protocols to ensure high-quality viral genetic material

    • Implementation of quality control measures to prevent cross-contamination

    • Storage of samples in appropriate conditions to maintain RNA integrity

  • Molecular Detection and Characterization:

    • RT-PCR targeting conserved regions for initial HCoV-OC43 identification

    • Amplification of multiple genomic regions including RdRp, spike, and nucleocapsid genes for comprehensive analysis

    • Complete genome sequencing of representative strains from each genotype or unusual variants

    • Next-generation sequencing to detect minor variants and quasi-species diversity

  • Phylogenetic Analysis Techniques:

    • Construction of phylogenetic trees using maximum likelihood methods for different genomic regions

    • Identification of incongruent phylogenetic positions that may indicate recombination events

    • Application of Bayesian MCMC approaches for divergence time calculations

    • Model selection using Bayes factor analysis to determine optimal evolutionary models

  • Recombination Detection Methods:

    • Bootscan analysis to identify potential recombination breakpoints

    • Statistical testing of recombination signals using programs like RDP4

    • Confirmation of recombination events through complete genome analysis

    • Characterization of recombination hot spots within the viral genome

  • Temporal and Geographical Tracking:

    • Time-stamped sequence analysis to monitor genotype prevalence over time

    • Geographical mapping of genotype distribution to identify regional patterns

    • Integration with clinical data to correlate genetic changes with disease presentation

    • Assessment of selection pressures through nonsynonymous/synonymous substitution rate analysis

These methodologies have revealed critical insights, such as the emergence of genotype D through recombination between genotypes B and C, and its association with pneumonia in elderly populations . The temporal analysis showing the shift from genotype C predominance (2004-2006) to genotype D predominance (2008-2011) demonstrates the value of sustained surveillance in tracking coronavirus evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.