Recombinant Human CTD nuclear envelope phosphatase 1 (CTDNEP1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

CTDNEP1 (UniProt: Q96KG9) belongs to the C-terminal domain phosphatase (CTDP) subfamily of magnesium-dependent HAD superfamily phosphatases . Key features include:

  • Molecular weight: 35 kDa (289 amino acids)

  • Catalytic motif: DxDxT at residues 67-71

  • Functional domains:

    • N-terminal amphipathic helix (residues 1-30) for membrane association

    • Rossmann-fold catalytic core (residues 50-250)

    • C-terminal region mediating NEP1R1 interaction

Recombinant production typically uses:

  • E. coli systems for crystallography studies

  • Mammalian cell lines (e.g., HEK293) for functional assays

ER Membrane Regulation

  • Dephosphorylates lipin-1 at S106/S107, enabling its nuclear translocation to promote phosphatidic acid conversion to diacylglycerol

  • Knockdown causes ER expansion (120% increase in ER volume vs controls)

Disease Associations

  • Medulloblastoma: 18% of SHH-subtype tumors harbor CTDNEP1 inactivating mutations

  • Lipid storage disorders: CTDNEP1ΔAH mutant fails to suppress lipid droplet biogenesis under oleate stress

Novel Signaling Roles

  • Interacts with MAN1 at the inner nuclear membrane to modulate TGF-β/SMAD signaling

  • Regulates SUN2 stability through dephosphorylation, affecting nuclear architecture

Key Mutants in Functional Studies

MutantPhenotypeApplication
CTDNEP1(D67E/D69T)Catalytically inactiveSubstrate trapping assays
CTDNEP1(V233E)Disrupts NEP1R1 bindingStudying complex dependency
CTDNEP1ΔAHCytosolic localizationMembrane association studies

Technical Advances

  • Cryo-EM studies: Enabled visualization of CTDNEP1-NEP1R1 complex bound to pseudo-substrate peptides

  • Fluorescent reporters: FRET-based systems quantify lipin-1 dephosphorylation kinetics

Stability and Purification Challenges

  • Requires co-expression with NEP1R1 for proper folding (solubility increases from 15% to 85%)

  • MBP fusion tags prevent aggregation during purification

  • Half-life in mammalian cells: 4.2 hr (extended to 12.8 hr with NEP1R1 co-expression)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that you may have specific requirements. If so, please indicate your desired format during order placement and we will fulfill your request.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributors for accurate delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipment is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is decided during production. If you have a preferred tag type, please inform us and we will prioritize its implementation.
Synonyms
CTDNEP1; DULLARD; CTD nuclear envelope phosphatase 1; Serine/threonine-protein phosphatase dullard
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CTDNEP1
Target Protein Sequence
MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Uniprot No.

Target Background

Function
CTDNEP1, a serine/threonine protein phosphatase, forms an active phosphatase complex with CNEP1R1. This complex dephosphorylates and potentially activates LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, thereby regulating fatty acid metabolism at various levels. CTDNEP1 may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes, playing a crucial role in proper nuclear membrane morphology and dynamics. It may also indirectly regulate the production of lipid droplets and triacylglycerol. Furthermore, CTDNEP1 may antagonize BMP signaling.
Gene References Into Functions
  1. CTDNEP1 is upregulated in non-alcoholic fatty liver disease. Increased levels of miR-122 can trigger a compensatory response involving LPIN1 and CTDNEP1 in hepatosteatosis. PMID: 28287811
  2. Dullard (CTDNEP1) participates in a unique phosphatase cascade regulating nuclear membrane biogenesis. This cascade is conserved from yeast to mammals. PMID: 17420445
Database Links

HGNC: 19085

OMIM: 610684

KEGG: hsa:23399

STRING: 9606.ENSP00000321732

UniGene: Hs.513913

Protein Families
Dullard family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein.
Tissue Specificity
Muscle specific with lower expression in other metabolic tissues.

Q&A

What is CTDNEP1 and what cellular functions does it perform?

CTDNEP1 (C-terminal Domain Nuclear Envelope Phosphatase 1) is a non-canonical protein serine/threonine phosphatase that regulates ER membrane biogenesis. It belongs to the C-terminal domain phosphatases (CTDPs) subfamily of the haloacid dehalogenase (HAD) superfamily of magnesium-dependent phosphatases. CTDNEP1 is required to maintain a dephosphorylated pool of lipin 1, a key phosphatidate phosphatase involved in lipid metabolism. Through its phosphatase activity, CTDNEP1 plays a critical role in restricting ER expansion and maintaining proper membrane homeostasis. Inactivating mutations in CTDNEP1 correlate with the development of medulloblastoma, an aggressive childhood cancer .

How does CTDNEP1 interact with NEP1R1 to form a functional complex?

CTDNEP1 forms an evolutionarily conserved complex with Nuclear Envelope Phosphatase 1 Regulatory Subunit 1 (NEP1R1), a transmembrane protein that acts as an activating regulatory subunit. NEP1R1 directly binds to CTDNEP1 at a site distant from the active site to stabilize and allosterically activate the phosphatase. This interaction is crucial for CTDNEP1 function, as knockdown of either CTDNEP1 or NEP1R1 in human cells generates identical phenotypes characterized by ER expansion. The binding occurs through the cytoplasmic domain of NEP1R1, which forms a helix that engages with a hydrophobic patch on CTDNEP1. This interaction not only enhances CTDNEP1's catalytic activity but also stabilizes the protein and prevents its aggregation .

What distinguishes CTDNEP1 from canonical phosphoprotein phosphatases?

CTDNEP1 represents a distinct class of phosphoprotein phosphatases that differs from canonical Ser/Thr phosphoprotein phosphatases (PP1-PP7) in several key aspects. CTDNEP1 has a characteristic Rossmann-like fold and utilizes a DxDx(V/T) active site motif typical of the HAD superfamily. It has different catalytic cores, metal-ion requirements, and reaction mechanisms compared to canonical phosphatases. While canonical phosphatases typically use metal ions like manganese or iron, CTDNEP1 is a magnesium-dependent phosphatase. Additionally, CTDNEP1 is primarily associated with the nuclear envelope and ER membrane, whereas many canonical phosphatases have broader cellular distributions .

What are the optimal conditions for expressing and purifying recombinant CTDNEP1?

The expression and purification of recombinant CTDNEP1 presents several challenges, primarily due to its tendency to aggregate when purified alone. Research has shown that most effective results are achieved through the following approaches:

  • Expression as a fusion protein with MBP (Maltose Binding Protein) significantly improves stability

  • Co-expression with NEP1R1 directly stabilizes CTDNEP1 and prevents aggregation

  • Using a construct lacking the N-terminal amphipathic helix (CTDNEP1ΔAH) improves solubility

  • Expression in E. coli with co-purification of the CTDNEP1-NEP1R1 complex yields stable, active protein

For biochemical studies, a soluble version of NEP1R1 (sNEP1R1) that lacks the transmembrane helices can be used, as it forms a stable 1:1 complex with CTDNEP1 and is sufficient to bind and activate the phosphatase .

How can researchers assess the phosphatase activity of CTDNEP1 in vitro?

The phosphatase activity of recombinant CTDNEP1 can be assessed using several approaches:

  • Using para-nitrophenyl phosphate (pNPP) as a colorimetric substrate

  • Employing 9-mer phosphor-peptides derived from lipin as more physiologically relevant substrates

  • Comparing activities of different complex formations (see table below)

Protein/ComplexRelative ActivityKey Observations
MBP-NEP1R1/CTDNEP1HighComplex with amphipathic helix shows highest activity
MBP-NEP1R1/CTDNEP1ΔAHModerateComplex lacking amphipathic helix shows reduced activity
MBP-CTDNEP1LowFull-length CTDNEP1 alone shows low activity and tends to aggregate
MBP-CTDNEP1ΔAHModerateCTDNEP1 lacking amphipathic helix shows higher activity than full-length
MBP-CTDNEP1ΔAH + NEP1R1HighAddition of NEP1R1 activates CTDNEP1ΔAH to levels comparable to co-purified complexes

These activity assays should be performed in the presence of magnesium ions, which are required for CTDNEP1's catalytic activity .

What structural biology approaches have been successful in characterizing the CTDNEP1-NEP1R1 complex?

High-resolution crystal structures of the CTDNEP1-NEP1R1 complex have been successfully determined using the following approaches:

  • Using a minimal NEP1R1 domain (sNEP1R1) that is sufficient to bind and activate CTDNEP1

  • Co-crystallizing the complex with a peptide sequence acting as a pseudosubstrate

  • Comparing experimental structures with AlphaFold Multimer predictions to identify conserved features

These structural studies have revealed that NEP1R1 engages CTDNEP1 at a site distant from the active site, and that substrate recognition is facilitated by a conserved Arg residue in CTDNEP1 that binds and orients the substrate peptide. The structural information explains how NEP1R1 allosterically activates CTDNEP1 and provides insights into how cancer-associated mutations might inactivate the phosphatase .

How does the CTDNEP1-NEP1R1 complex regulate ER membrane biogenesis?

The CTDNEP1-NEP1R1 complex plays a crucial role in regulating ER membrane biogenesis through the following mechanism:

  • CTDNEP1 dephosphorylates lipin 1, a phosphatidate phosphatase

  • Dephosphorylated lipin 1 can translocate to the ER/nuclear envelope membrane

  • At the membrane, lipin 1 catalyzes the conversion of phosphatidate to diacylglycerol

  • Diacylglycerol serves as a precursor for phospholipid synthesis

  • This regulated process helps maintain proper ER membrane homeostasis

Loss of either CTDNEP1 or NEP1R1 disrupts this pathway, leading to hyperphosphorylation of lipin 1, altered lipid metabolism, and consequently ER expansion. This regulatory function appears to be evolutionarily conserved from yeast to humans, underscoring its fundamental importance in eukaryotic cell biology .

What cellular phenotypes result from CTDNEP1 or NEP1R1 depletion?

Depletion of either CTDNEP1 or NEP1R1 in human cells generates identical phenotypes, primarily characterized by:

  • Significant expansion of the ER membrane

  • Altered lipid metabolism

  • Changes in nuclear envelope morphology

  • Dysregulation of lipin 1 phosphorylation and localization

The observation that NEP1R1 knockdown phenocopies CTDNEP1 knockdown establishes that CTDNEP1-NEP1R1 functions as an obligate complex in mammalian cells. This is consistent with studies in yeast, where disruption of either Nem1 (CTDNEP1 ortholog) or Spo7 (NEP1R1 ortholog) results in the same phenotypes, including expanded nuclear envelope morphology and defects in sporulation .

Does CTDNEP1 have substrates beyond lipin 1?

While lipin 1 is the best-characterized substrate of CTDNEP1, the broader substrate specificity of this phosphatase remains an active area of investigation. The crystal structures of the CTDNEP1-NEP1R1 complex have provided insights into substrate recognition, showing that a conserved Arg residue in CTDNEP1 binds and orients the substrate peptide in the active site. This structural information could help predict other potential substrates based on sequence similarity around phosphorylation sites. Further research using phosphoproteomic approaches comparing wild-type and CTDNEP1-deficient cells could identify additional substrates, potentially revealing new roles for CTDNEP1 beyond ER membrane regulation .

How do mutations in CTDNEP1 contribute to medulloblastoma development?

Inactivating mutations in CTDNEP1 correlate with the development of medulloblastoma, an aggressive childhood cancer. The molecular mechanisms linking CTDNEP1 dysfunction to cancer development involve:

  • Dysregulation of lipid metabolism due to hyperphosphorylated lipin 1

  • Altered ER/nuclear envelope membrane homeostasis

  • Potential disruption of cellular signaling pathways affected by membrane composition

Crystal structures of the CTDNEP1-NEP1R1 complex have provided insights into how cancer-associated mutations might inactivate CTDNEP1, either by disrupting its catalytic activity, impairing its interaction with NEP1R1, or affecting substrate recognition. Understanding these mechanisms could inform the development of targeted therapeutic approaches for medulloblastoma patients with CTDNEP1 mutations .

Can structural information about CTDNEP1-NEP1R1 be leveraged for drug discovery?

The high-resolution crystal structures of the CTDNEP1-NEP1R1 complex provide valuable templates for structure-based drug design approaches. Potential strategies include:

  • Developing small molecules that mimic NEP1R1's activating effect on CTDNEP1

  • Designing compounds that enhance the stability of the CTDNEP1-NEP1R1 complex

  • Creating substrate-competitive inhibitors targeting the active site, particularly focusing on the conserved Arg residue involved in substrate recognition

How can researchers investigate the dynamics of CTDNEP1-NEP1R1 interactions in living cells?

Investigating the dynamics of CTDNEP1-NEP1R1 interactions in living cells requires advanced imaging techniques:

  • Fluorescence Resonance Energy Transfer (FRET) using fluorescently tagged CTDNEP1 and NEP1R1 to monitor their interaction in real-time

  • Super-resolution microscopy to visualize the subcellular localization of the complex with nanometer precision

  • Live-cell imaging to track the dynamics of CTDNEP1 and NEP1R1 in response to various cellular stimuli

  • Correlative light and electron microscopy to examine the relationship between CTDNEP1-NEP1R1 localization and ER/nuclear envelope ultrastructure

These approaches could reveal how the formation and activity of the CTDNEP1-NEP1R1 complex are regulated in space and time within living cells, providing insights into the cellular contexts that modulate CTDNEP1 function .

What is the significance of the allosteric activation of CTDNEP1 by NEP1R1?

The allosteric activation of CTDNEP1 by NEP1R1 represents an important regulatory mechanism with several implications:

  • It provides a means to control CTDNEP1 activity without directly affecting the active site

  • The physical separation between the NEP1R1 binding site and the CTDNEP1 active site suggests the existence of conformational changes that transmit the activating effect

  • This mechanism might be exploited by other regulatory proteins that could compete with NEP1R1 for binding to CTDNEP1

  • Understanding the structural basis of this allosteric activation could inform the design of small molecule modulators of CTDNEP1 activity

Investigating the molecular details of this allosteric mechanism, potentially through hydrogen-deuterium exchange mass spectrometry or molecular dynamics simulations, could provide deeper insights into CTDNEP1 regulation .

How can researchers resolve discrepancies between experimental structures and AI-predicted models of the CTDNEP1-NEP1R1 complex?

Resolving discrepancies between experimental crystal structures and AlphaFold Multimer predictions of the CTDNEP1-NEP1R1 complex requires a multi-faceted approach:

  • Obtaining additional experimental structures of either the full-length complex or alternative constructs

  • Using solution-based structural techniques like small-angle X-ray scattering (SAXS) or cryo-electron microscopy

  • Performing molecular dynamics simulations to explore the conformational flexibility of the complex

  • Conducting biochemical and biophysical experiments to test specific structural hypotheses

Notable discrepancies include differences in the orientation of the second helix of NEP1R1 and the extent of the cytoplasmic domain. Resolving these differences is important for accurately understanding the structural basis of CTDNEP1 regulation and could have implications for structure-based drug design efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.