Recombinant Human Cutaneous T-cell lymphoma-associated antigen 4 (CTAGE4)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Features

  • Gene: CTAGE4 (HGNC symbol) is located on chromosome 7q35 .

  • Protein: CTAGE4 is a 74–80 kDa protein with no significant homology to known functional domains, suggesting unique structural properties .

  • Family: Part of the CTAGE family, which includes multiple members (e.g., CTAGE-1, CTAGE-5) with tumor-specific splicing variants .

Immunogenic Properties

  • CTAGE4 is immunogenic, with seroreactivity observed in CTCL and melanoma patients but not in healthy controls .

  • Epitope mapping of related CTAGE proteins (e.g., CTAGE-1) reveals conformational epitopes recognized by patient-derived antibodies .

Expression Profiles

CTAGE4 exhibits a restricted expression pattern, typical of cancer-testis antigens:

Tissue/Cell TypeExpression LevelMethodSource
Normal TestisHighRT-PCR, IHC
CTCL TumorsModerate-HighWestern Blot, SEREX
Melanoma Cell LinesVariableRT-PCR
Normal Non-Testicular TissuesUndetectable/LowRNA-seq, IHC

Key Findings:

  • Tumor-specific expression in 35% of CTCL cases and select carcinomas (e.g., head and neck squamous cell carcinoma) .

  • No expression in activated T-cells or benign inflammatory dermatoses .

Role in Cutaneous T-Cell Lymphoma (CTCL)

CTAGE4 is implicated in CTCL pathogenesis and immune evasion:

  • Immunological Target: Ectopic expression in tumors triggers antibody responses in patients, suggesting its role as a tumor-associated antigen .

  • Therapeutic Relevance:

    • CTAGE4’s restricted expression makes it a candidate for immunotherapy (e.g., vaccines, CAR-T cells) .

    • Histone deacetylase (HDAC) inhibitors upregulate CTAGE family members in CTCL cell lines, enhancing immunogenicity .

Research Gaps and Challenges

  • Functional Studies: The biological role of CTAGE4 in tumorigenesis remains uncharacterized.

  • Recombinant Production: Limited data exist on recombinant CTAGE4 protein synthesis or its use in functional assays.

  • Clinical Validation: No clinical trials targeting CTAGE4 have been reported, unlike related antigens (e.g., NY-ESO-1).

Comparative Analysis of CTAGE Family Members

FeatureCTAGE4CTAGE-1CTAGE-5
Chromosomal Location7q35 18p11.2 15q21
Tumor ExpressionCTCL, Melanoma CTCL, Carcinomas CTCL, Breast Cancer
ImmunogenicityModerate High Moderate

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CTAGE4; cTAGE family member 4; Protein cTAGE-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-777
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CTAGE4
Target Protein Sequence
MEEPGATPQPYLGLVLEELRRVVAALPESMRPDENPYGFPSELVVCAAVIGFFVVLLFLW RSFRSVRSRLYVGREQKLGATLSGLIEEKCKLLEKFSLIQKEYEGYEVESSLEDASFEKA AAEEARSLEATCEKLNRSNSELEDEILCLEKDLKEEKSKHSQQDELMADISKSIQSLEDE SKSLKSQIAEAKIICKTFKMSEERRAIAIKDALNENSQLQTSHKQLFQQEAEVWKGEVSE LNKQKITFEDSKVHAEQVLNDKENHIKTLTGHLPMMKDQAAVLEEDTTDDDNLELEVNSQ WENGANLDDPLKGALKKLIHAAKLNVSLKSLEGERNHIIIQLSEVDKTKEELTEHIKNLQ TQQASLQSENIYFESENQKLQQKLKIMTEFYQENEMKLYRKLTVEENYRIEEEEKLSRVE EKISRATEGLETYRKLAKDLEEELERTVHFYQKQVISYEKRGHDNWLAARTAERNLSDLR KENAHNKQKLTETELKFELLEKDPNALDVSNTAFGREHSPCSPSPLGRPSSETRAFPSPQ TLLEDPLRLSPVLPGGGGRGPSSPGNPLDHQITNERGEPSYDRLIDPHRAPSDTGSLSSP VEQDRRMMFPPPGQSYPDSTLPPQREDRFYSNSERLSGPAEPRSFKMTSLDKMDRSMPSE MESSRNDAKDDLGNLNVPDSSLPAENEATGPGLIPPPLAPISGPLFPVDTRGPFMRRGPP FPPPPPGTMFGASRGYFPPRDFPGPPHAPFAMRNIYPPRGLPPYLHPRPGFYPNPTF
Uniprot No.

Target Background

Function
Tumor-associated antigen.
Database Links

HGNC: 24772

OMIM: 608910

KEGG: hsa:100128553

UniGene: Hs.645204

Protein Families
CTAGE family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in testis, placenta and skin. Expressed at lower level in mammary gland and stomach.

Q&A

What is CTAGE4 and how does it relate to the broader CTAGE gene family?

CTAGE4 belongs to the cutaneous-T-cell-lymphoma-associated antigen (cTAGE) gene family, which was initially identified through serologic identification of antigens by recombinant expression cloning. The CTAGE family comprises multiple members, including cTAGE-1, cTAGE-1B, cTAGE-4, cTAGE-5A, and cTAGE-5B, with varying expression patterns and functions .

The CTAGE family is classified as cancer/testis (CT) antigens, characterized by their restricted expression primarily in testis and various tumor tissues. Evolutionary analysis indicates that the CTAGE gene family has undergone rapid and primate-specific expansion, starting with an ancestral retroposition in the haplorhini ancestor and subsequent DNA-based duplications . This expansion was particularly pronounced in humans, suggesting potential adaptive significance during primate evolution.

Molecular studies have identified mutations in CTAGE4 that may be associated with certain multisystemic diseases characterized by growth retardation, intellectual disability, joint contracture, and hepatopathy , suggesting broader biological roles beyond cancer contexts.

What expression patterns characterize CTAGE4 in normal and cancerous tissues?

While comprehensive expression data specific to CTAGE4 is limited in the current literature, insights from studies on the CTAGE family suggest a restricted expression pattern:

CTAGE Family MemberExpression in Normal TissuesExpression in Tumor TissuesDetection Method
cTAGE-1, cTAGE-1B, cTAGE-5ARestricted to testisPresent in multiple tumor typesRT-PCR
cTAGE-4 and other membersFound in 2-8 normal tissues (of 27 tested)Detected in multiple tumor typesRT-PCR, Western blotting

Sero-reactivity against cTAGE-4 has been documented exclusively in tumor patients (cutaneous T cell lymphoma and melanoma), indicating its potential as a tumor-specific marker . CTAGE members, including cTAGE-4, have been detected at variable frequencies in diverse tumor tissues and cell lines, including:

  • Cutaneous T cell lymphoma

  • Melanoma

  • Head and neck squamous cell carcinoma

  • Breast carcinoma

  • Colon carcinoma

Single-cell transcriptomic analyses of cutaneous T-cell lymphoma have revealed associations between certain cancer testis genes and advanced disease stages, suggesting potential roles in disease progression .

How was CTAGE4 initially characterized and what methodologies were used?

The initial characterization of the CTAGE gene family, including CTAGE4, employed several complementary approaches:

  • Serologic Identification: The original identification utilized serologic identification of antigens by recombinant expression cloning, establishing cTAGE-1 as a cutaneous-T-cell-lymphoma-specific tumor antigen .

  • Molecular Cloning Techniques: Additional members, including CTAGE4, were identified through rapid amplification of cDNA ends (RACE) and DNA screening .

  • Expression Analysis: Reverse transcription polymerase chain reaction (RT-PCR) was employed to characterize expression patterns across tissues .

  • Protein Detection: Western blotting confirmed tumor-specific expression of CTAGE family proteins .

  • Immunological Characterization: Epitope mapping using sera from cutaneous T cell lymphoma patients identified immunogenic regions within CTAGE proteins .

  • Genomic Analysis: More recent studies have utilized next-generation sequencing to identify specific mutations in CTAGE4. In one multisystemic disease case, genome sequencing using Solexa technology identified heterozygous mutations in CTAGE4 (chr7, c.143964657T>C, p.S563G and chr7, c.143964658G>T, p.S562R) .

These methodologies established CTAGE4 as part of a gene family with potential significance in cancer biology and other pathological conditions.

How does CTAGE4 contribute to lymphoma pathogenesis and what experimental evidence supports this role?

The specific role of CTAGE4 in cutaneous T-cell lymphoma (CTCL) pathogenesis requires further elucidation, but current evidence suggests several potential mechanisms:

  • Association with Cancer/Testis Antigen Function: As a member of the cancer/testis antigen family, aberrant expression of CTAGE4 in tumor cells may contribute to immune evasion or promote proliferative pathways .

  • Transcriptional Program Regulation: Single-cell transcriptomic studies have identified distinct meta-programs in malignant T cells in CTCL. Meta-program analysis revealed that a high proliferation signature predicted poor patient outcomes (HR: 2.19, p<0.05), while T cell activation signatures were associated with favorable prognosis . The potential regulation of these programs by CTAGE4 warrants investigation.

  • Immunogenicity: Demonstrated sero-reactivity against CTAGE4 in CTCL patients suggests recognition by the immune system, which may shape tumor-immune interactions within the microenvironment .

  • Association with Advanced Disease: Other cancer testis genes, such as GTSF1, show increased expression in advanced CTCL and correlate with poor prognosis. Similar patterns may exist for CTAGE4, suggesting roles in disease progression .

Research Gaps and Future Directions:

  • Functional studies using gene silencing or CRISPR-Cas9 editing in CTCL cell lines

  • Comprehensive expression profiling across different disease stages

  • Investigation of CTAGE4-regulated genes and pathways in malignant T cells

  • Exploration of potential interactions with other oncogenic factors

What are the challenges and considerations in developing CTAGE4-targeted therapies?

Developing effective CTAGE4-targeted therapies presents several challenges that must be addressed through rigorous research:

Biological Challenges:

  • Expression Heterogeneity: Variable frequencies of CTAGE detection in tumor tissues suggest heterogeneous expression , potentially limiting therapeutic efficacy to patient subsets.

  • Functional Redundancy: The presence of multiple CTAGE family members raises questions about functional redundancy, which may necessitate targeting multiple family members simultaneously.

  • Target Accessibility: If CTAGE4 is primarily intracellular, as are many cancer/testis antigens, direct targeting with conventional antibodies may be challenging, requiring alternative approaches.

Technical Considerations:

  • Specificity: Ensuring therapeutic agents specifically target CTAGE4 without cross-reactivity to other CTAGE family members requires careful epitope selection and validation.

  • Delivery Systems: For intracellular targets, developing effective delivery systems (nanoparticles, cell-penetrating peptides, etc.) may be necessary.

  • Patient Selection: Companion diagnostics to identify patients with CTAGE4-expressing tumors would be essential for clinical trial design and eventual therapeutic application.

Therapeutic Approaches with Potential:

  • Immunotherapeutic Strategies:

    • Cancer vaccines using CTAGE4 epitopes

    • Adoptive T cell therapy with CTAGE4-specific TCRs

    • Bispecific antibodies to redirect T cell cytotoxicity

  • Targeted Protein Degradation:

    • PROTACs (Proteolysis Targeting Chimeras) targeting CTAGE4

    • Autophagy-inducing compounds specific to CTAGE4-expressing cells

  • Gene Silencing Approaches:

    • siRNA or antisense oligonucleotides targeting CTAGE4 mRNA

    • CRISPR-based approaches for gene inactivation

Addressing these challenges requires comprehensive characterization of CTAGE4 function, expression patterns, and immunological properties to develop rationally designed therapeutic strategies.

How does evolutionary analysis inform our understanding of CTAGE4 function?

Evolutionary analysis provides valuable insights into CTAGE4's potential functions and importance:

The CTAGE gene family has undergone remarkable evolutionary changes:

  • Primate-Specific Expansion: The family shows rapid expansion specifically in primates, with the greatest proliferation in humans .

  • Origin and Diversification: The expansion began with an ancestral retroposition in the haplorhini ancestor, followed by DNA-based duplications leading to an increase in single-exon CTAGE copies in catarrhines (Old World monkeys and apes) .

  • Selective Pressures: Distinct patterns of selection are evident:

    • Single-exon copies show evidence of positive selection

    • Multi-exon copies demonstrate functional constraint

This evolutionary pattern suggests:

Functional Implications:

  • Potential Adaptive Advantage: The human-specific expansion suggests CTAGE genes may confer advantageous traits in human evolution .

  • Regulatory Innovation: Newly derived CTAGE genes appear to have acquired regulatory elements from long terminal repeats, potentially enabling novel expression patterns .

  • Functional Divergence: The differential selection patterns between single-exon and multi-exon copies suggest functional diversification within the family .

Comparative Data Across Selected Primates:

SpeciesCTAGE Gene Copy NumberEvidence of SelectionNotable Features
HumanHighestPositive selection on single-exon copiesGreatest expansion
ChimpanzeeHighSimilar to humans-
GorillaHighSimilar to humans-
OrangutanModerate--
MacaqueLower than great apes--
MarmosetLowest among studied primates-Early stage of expansion

These evolutionary insights suggest that CTAGE4 may perform functions particularly relevant to human biology, potentially including roles in immunity, reproduction, or tissue-specific processes that differentiate humans from other primates.

What are the current gaps in CTAGE4 research and promising future directions?

Despite progress in understanding the CTAGE gene family, significant knowledge gaps remain regarding CTAGE4 specifically:

Current Research Gaps:

  • Molecular Function: The precise biochemical and cellular functions of CTAGE4 remain largely undefined.

  • Signaling Pathways: The signaling networks involving CTAGE4 and its potential role in critical cellular processes require clarification.

  • Structure-Function Relationship: Detailed structural information and its relationship to function is lacking.

  • Regulation: Mechanisms controlling CTAGE4 expression in normal and pathological contexts remain to be elucidated.

  • Clinical Correlations: Comprehensive analysis of CTAGE4 expression across disease stages and correlation with clinical outcomes is needed.

Promising Research Directions:

  • Comprehensive Expression Profiling:

    • Single-cell RNA sequencing across normal and pathological tissues

    • Spatial transcriptomics to understand tissue context

    • Correlation with clinical parameters in larger patient cohorts

  • Functional Genomics:

    • CRISPR-Cas9 screening to identify synthetic lethal interactions

    • Conditional knockout models to assess tissue-specific functions

    • ChIP-seq and ATAC-seq to understand regulatory mechanisms

  • Structural Biology:

    • Cryo-EM or X-ray crystallography to determine three-dimensional structure

    • Identification of functional domains and potential binding partners

    • Rational design of inhibitors based on structural insights

  • Translational Applications:

    • Development of diagnostic assays for CTAGE4 expression

    • Exploration of CTAGE4 as an immunotherapeutic target

    • Investigation of correlations with response to existing therapies

  • Integration with Multi-Omics Data:

    • Combined analysis of genomic, transcriptomic, proteomic, and epigenomic data

    • Systems biology approaches to place CTAGE4 within broader cellular networks

    • Machine learning models to predict CTAGE4 function and clinical relevance

Addressing these research directions will require collaborative efforts across disciplines and the development of novel experimental approaches tailored to the unique challenges presented by CTAGE4 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.