Recombinant Human Cutaneous T-cell lymphoma-associated antigen 8 (CTAGE8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Cutaneous T-cell Lymphoma-associated Antigen 8 (CTAGE8)

Recombinant Human Cutaneous T-cell lymphoma-associated antigen 8 (CTAGE8) is a protein associated with cutaneous T-cell lymphoma, a type of cancer that affects the skin. CTAGE8 is part of a family of proteins known as cancer/testis antigens, which are typically expressed in testicular germ cells but can also be found in various types of tumors. This antigen is of interest in cancer research due to its potential role in tumor development and its utility as a target for immunotherapy.

Structure and Function of CTAGE8

CTAGE8 is a member of the CTAGE family, which includes several proteins with similar structures and functions. These proteins are characterized by their expression in cancer cells and their potential to elicit immune responses. The structure of CTAGE8 includes specific domains that may interact with other cellular components, influencing cell signaling pathways and potentially contributing to oncogenesis.

Research Findings on CTAGE8

Recent studies have highlighted the involvement of CTAGE8 in cancer biology. For instance, it has been observed that CTAGE8 is downregulated in certain types of lung cancer, suggesting its potential role in tumor suppression or as a biomarker for cancer progression . Additionally, CTAGE8 is part of paralogous gene groups that exhibit copy number variability in the human genome, which can affect gene expression and function .

Future Directions

Future studies should focus on elucidating the molecular mechanisms by which CTAGE8 influences cancer progression and exploring its potential as a therapeutic target. This may involve investigating the expression of CTAGE8 in various cancer types, its interaction with other cellular components, and its role in modulating immune responses.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CTAGE8; cTAGE family member 8; Protein cTAGE-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-777
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CTAGE8
Target Protein Sequence
MEEPGATPQPYLGLVLEELRRVVAALPESMRPDENPYGFPSELVVCAAVIGFFVVLLFLW RSFRSVRSRLYVGREQKLGATLSGLIEEKCKLLEKFSLIQKEYEGYEVESSLEDASFEKA AAEEARSLEATCEKLNRSNSELEDEILCLEKDLKEEKSKHSQQDELMADISKSIQSLEDE SKSLKSQIAEAKIICKTFKMSEERRAIAIKDALNENSQLQTSHKQLFQQEAEVWKGQVSE LNKQKITFEDSKVHAEQVLNDKENHIKTLTGHLPMMKDQAAVLEEDTTDDDNLELEVNSQ WENGANLDDPLKGALKKLIHAAKLNVSLKSLEGERNHIIIQLSEVDKTKEELTEHIKNLQ TQQASLQSENIYFESENQKLQQKLKIMTEFYQENEMKLYRKLTVEENYRIEEEEKLSRVE EKISRATEGLETYRKLAKDLEEELERTVHFYQKQVISYEKRGHDNWLAARTAERNLSDLR KENAHNKQKLTETELKFELLEKDPNALDVSNTAFGREHSPCSPSPLGRPSSETRAFPSPQ TLLEDPLRLSPVLPGGGGRGPSSPGNPLDHQITNERGEPSYDRLIDPHRAPSDTGSLSSP VEQDRRMMFPPPGQSYPDSTLPPQREDRFYSNSERLSGPAEPRSFKMTSLDKMDRSMPSE MESSRNDAKDDLGNLNVPDSSLPAENEATGPGFIPPPLAPVRGPLFPVDTRGPFMRRGPP FPPPPPGTMFGASRGYFPPRDFPGPPHAPFAMRNIYPPRGLPPYLHPRPGFYPNPTF
Uniprot No.

Target Background

Database Links

HGNC: 37294

KEGG: hsa:100142659

UniGene: Hs.661442

Protein Families
CTAGE family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CTAGE8 and how does it relate to the cTAGE gene family?

CTAGE8 (Cutaneous T-cell lymphoma-associated antigen 8) belongs to the cTAGE gene family, which includes several paralogs with highly similar sequences. The cTAGE gene family was initially identified through serologic identification of antigens by recombinant expression cloning, with cTAGE-1 being the first characterized as a cutaneous T-cell lymphoma-specific tumor antigen . Analysis of genomic data reveals that CTAGE8 forms a paralog group with CTAGE9, demonstrating significant sequence similarity that complicates distinct identification in standard genomic analyses .

The cTAGE family includes several differentially spliced genes, such as cTAGE-1/2 and cTAGE-5, with variations in their expression patterns across tissues. While some family members show restricted expression primarily in testis and tumor tissues (like cTAGE-1, cTAGE-1B, and cTAGE-5A), others, potentially including CTAGE8, are found in multiple normal tissues, though specific expression patterns vary considerably .

How can researchers accurately detect CTAGE8 expression in biological samples?

Detection of CTAGE8 expression requires careful consideration of its sequence similarity with paralogs, particularly CTAGE9. Recommended methodological approaches include:

  • RNA-sequencing with specialized analysis pipelines: When performing RNA-seq, researchers should implement computational approaches specifically designed to distinguish between highly similar paralogs. This may include analysis of unique exon-junction reads or paralog-specific sequence variants .

  • RT-PCR with paralog-specific primers: Design primers targeting unique regions that differentiate between CTAGE8 and other family members, particularly CTAGE9. Validation should include sequencing of amplicons to confirm specificity .

  • Western blotting with validated antibodies: When performing protein detection, use antibodies that have been validated for specificity against CTAGE8 versus other family members. Cross-reactivity testing is essential .

  • Single-cell approaches: To resolve cell-type specific expression, single-cell RNA-seq can provide higher resolution data on CTAGE8 expression patterns, though computational challenges in paralog discrimination remain .

What expression pattern does CTAGE8 show in normal versus tumor tissues?

Based on analyses of the cTAGE gene family, CTAGE8 appears to show differential expression between normal and tumor tissues. While detailed CTAGE8-specific expression data is limited in the literature, research on related family members provides valuable insights:

The cTAGE gene family demonstrates variable expression patterns, with some members (cTAGE-1, cTAGE-1B, and cTAGE-5A) showing highly restricted expression primarily in testis and tumor tissues . This pattern is characteristic of cancer-testis antigens. Other cTAGE members show broader expression, being found in multiple normal tissues.

Research has demonstrated that various cTAGE family proteins (cTAGE-1, cTAGE-4, cTAGE-5A, and cTAGE-5B) can be detected in multiple tumor types, including cutaneous T cell lymphoma, melanoma, head and neck squamous cell carcinoma, breast carcinoma, and colon carcinoma, though at variable frequencies . This suggests that CTAGE8 may similarly be expressed in various cancer types, making it a potential cancer biomarker or immunotherapy target.

What is known about the copy number variation of CTAGE8 in human populations?

CTAGE8 exhibits notable copy number (CN) variation across human populations, a feature that has important implications for research:

Genome-wide profiling studies have identified CTAGE8/CTAGE9 as a paralog group with true copy number variability in human populations . This finding contradicts earlier classifications that considered this region as a false duplication in the GRCh38 reference genome. Analysis of 259 unrelated individuals across five ancestral populations revealed that CTAGE8/CTAGE9 belongs to the category of paralog groups with high CN variability, defined as less than 80% of individuals having the mode CN value .

This CN variability has significant implications for research:

  • It suggests evolutionary dynamics that may be relevant to function

  • It necessitates careful genomic analysis when studying CTAGE8

  • It may contribute to differential expression or function across populations

  • It requires population-specific considerations in clinical applications

Such copy number variation also highlights the importance of using comprehensive genomic approaches that can accurately assess CN status when studying CTAGE8 in different populations .

How can researchers differentiate between CTAGE8 and its paralog CTAGE9?

Differentiating between CTAGE8 and CTAGE9 presents a significant methodological challenge due to their high sequence similarity. Researchers should employ the following approaches:

The challenge of paralog discrimination is illustrated by research showing that CTAGE8/CTAGE9 was previously misclassified as a false duplication in reference genomes, highlighting the complexity of accurately annotating and analyzing these regions .

What is the significance of CTAGE8 down-regulation in JEG-3 cells during Zika virus infection?

The down-regulation of CTAGE8 in JEG-3 human placental choriocarcinoma cells during Zika virus (ZIKV) infection provides important insights into potential functional roles:

Transcriptomic analysis identified CTAGE8 as one of the significantly down-regulated genes (ranked 6th among down-regulated genes) in JEG-3 cells at 24 hours post-infection with ZIKV . This finding is particularly notable as JEG-3 cells showed relatively fewer differentially expressed genes (142 up-regulated and 32 down-regulated) compared to other cell types like U-251 MG and HK-2 cells during ZIKV infection .

The down-regulation of CTAGE8 in placental cells specifically might indicate:

  • A potential role in antiviral immune responses in the placenta

  • Viral manipulation of host pathways involving CTAGE8

  • Cell type-specific functions that are disrupted during infection

  • Potential contribution to placental pathology during congenital ZIKV infection

This observation should be considered in the context of ZIKV's known tropism for placental cells and its ability to cause congenital infections. The tissue-specific nature of this response is highlighted by the fact that different cell types (JEG-3, U-251 MG, and HK-2) showed distinct transcriptional responses to ZIKV infection .

How might CTAGE8 be involved in the pathology of cutaneous T-cell lymphoma?

The potential involvement of CTAGE8 in cutaneous T-cell lymphoma (CTCL) pathology can be inferred from studies of related cTAGE family members:

The cTAGE gene family was initially identified through studies of CTCL, with cTAGE-1 characterized as a CTCL-specific tumor antigen . Research has demonstrated that various cTAGE family proteins (cTAGE-1, cTAGE-4, cTAGE-5A, and cTAGE-5B) can be detected in CTCL tissues and cell lines .

The potential pathological significance includes:

  • Immunogenic properties: Several cTAGE family members demonstrate tumor-specific protein expression and sero-reactivity in CTCL patients, suggesting they may serve as tumor antigens recognized by the immune system .

  • Cancer-specific expression patterns: Some cTAGE family members show restricted expression patterns, being found primarily in testis and tumor tissues, characteristic of cancer-testis antigens .

  • Alternative splicing relevance: Research indicates that tumor-specific splicing of cTAGE genes may generate unique protein variants in cancer cells. These variants could contribute to pathogenesis or serve as specific targets for immunotherapy .

  • Biomarker potential: The detection of cTAGE family proteins in various tumor types at different frequencies suggests potential utility as diagnostic or prognostic biomarkers .

While direct evidence for CTAGE8's specific role in CTCL pathology is limited, its classification as a CTCL-associated antigen and its relationship to other cTAGE family members suggests potential involvement in tumor-specific processes.

What experimental techniques are most effective for studying CTAGE8 function?

Investigating CTAGE8 function requires specialized approaches that address the challenges of paralog similarity and copy number variation. The following methodological framework is recommended:

  • Gene expression modification approaches:

    • CRISPR-Cas9 gene editing with careful design of guide RNAs to ensure specificity for CTAGE8 versus paralogs

    • siRNA or shRNA knockdown with extensive validation of target specificity

    • Overexpression studies using epitope-tagged constructs to facilitate detection

  • Protein interaction studies:

    • Immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Yeast two-hybrid screening with validation through co-immunoprecipitation

    • Proximity labeling approaches (BioID, APEX) to identify proximal proteins in living cells

  • Functional assays:

    • Assessment of cellular phenotypes (proliferation, migration, apoptosis) following CTAGE8 modulation

    • Viral infection models to investigate the significance of CTAGE8 down-regulation during infection

    • Immune response assays to evaluate potential roles in antigen presentation or T-cell activation

  • High-throughput approaches:

    • RNA-seq with specialized analysis pipelines capable of distinguishing between paralogs

    • Proteomics with attention to paralog-specific peptides

    • Single-cell analysis to resolve cell type-specific functions

The implementation of these techniques requires careful attention to controls that can distinguish between CTAGE8 and its paralogs, particularly CTAGE9 .

What are the current research gaps and future directions for CTAGE8 studies?

Current research on CTAGE8 presents several significant gaps and opportunities for future investigation:

  • Functional characterization: Despite associations with cancer and viral responses, the molecular function of CTAGE8 remains poorly defined. Future research should focus on identifying its subcellular localization, interaction partners, and biochemical activities.

  • Paralog-specific analysis: The high sequence similarity between CTAGE8 and CTAGE9 necessitates the development of improved methods for paralog-specific analysis . This includes:

    • Advanced computational approaches for distinguishing between paralogs in sequencing data

    • Development of paralog-specific antibodies and detection methods

    • CRISPR-based approaches that can target individual paralogs

  • Clinical relevance assessment:

    • Comprehensive profiling of CTAGE8 expression across cancer types beyond CTCL

    • Evaluation of its potential as a diagnostic biomarker or immunotherapy target

    • Investigation of correlations between CTAGE8 expression or copy number and clinical outcomes

  • Evolutionary and population genetics:

    • Further characterization of copy number variation across diverse populations

    • Investigation of selection pressures that may have shaped CTAGE8 evolution

    • Functional implications of population-specific genomic variations

  • Role in viral pathogenesis:

    • Exploration of the mechanisms and consequences of CTAGE8 down-regulation during ZIKV infection

    • Investigation of potential interactions with viral proteins

    • Assessment of its role in other viral infections beyond ZIKV

  • Cancer immunology:

    • Evaluation of CTAGE8 as a potential cancer-testis antigen or tumor-specific antigen

    • Assessment of its immunogenicity and potential for immunotherapy development

    • Investigation of tumor-specific alternative splicing that may generate unique epitopes

Differential Expression of CTAGE8 in Viral Infection Models

The following table summarizes the ranking of down-regulated genes in JEG-3 cells during ZIKV infection, including CTAGE8:

RankingDown-regulated genes in JEG-3 cells
1POTEG
2HPN
3CATSPERE
4CD22
5INPP5J
6CTAGE8
7ZNF221
8CYP1A1
9AC136616.1
10ZNF846

This data demonstrates the significant down-regulation of CTAGE8 during ZIKV infection of placental cells .

Copy Number Variation Analysis of CTAGE8/CTAGE9 Paralog Group

Recent genome-wide profiling of highly similar paralogous genes has revealed important information about CTAGE8/CTAGE9 copy number variation:

The CTAGE8/CTAGE9 paralog group has been identified as a region with true copy number variability in human populations, contradicting previous classifications as a false duplication in the GRCh38 reference genome . This paralog group falls into the category of high copy number variability, defined as less than 80% of individuals having the mode CN value.

This finding has significant implications for research design and interpretation, particularly for studies involving genomic analysis of CTAGE8. It highlights the importance of using comprehensive genomic approaches that can accurately assess copy number status when studying CTAGE8 in different populations .

Methodological Recommendations for CTAGE8 Research

For researchers pursuing studies on CTAGE8, the following methodological approaches are recommended:

  • Implement specialized genomic analysis pipelines capable of distinguishing between highly similar paralogs when performing sequencing studies .

  • Utilize high-fidelity sequencing approaches and calculate paralog-specific mapping quality (MAPQ) to identify uniquely mappable regions .

  • Carefully validate the specificity of detection methods (primers, antibodies) against other cTAGE family members, particularly CTAGE9.

  • Consider population diversity and copy number variation when designing genomic studies .

  • Integrate multiple experimental approaches (genomic, transcriptomic, proteomic) to build comprehensive understanding of CTAGE8 function.

  • Develop paralog-specific gene editing approaches for functional studies to avoid confounding effects from CTAGE9.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.