Recombinant Human CX3C chemokine receptor 1 (CX3CR1)

Shipped with Ice Packs
In Stock

Description

Receptor Classification and Nomenclature

CX3CR1 is classified as a transmembrane protein belonging to the G protein-coupled receptor 1 (GPCR1) family and stands as the sole member of the CX3C chemokine receptor subfamily . The receptor has been previously known by several alternative designations including V28, CCRL1, GPR13, CMKDR1, GPRV28, and CMKBRL1 . It was initially classified as an orphan receptor named V28 or CMKBRL1 (chemokine beta receptor-like 1) until its specific ligand was identified . The current nomenclature follows the systematic classification of chemokine receptors, with "CX3C" denoting the specific chemokine subfamily it interacts with, followed by "R1" indicating it is the first (and only) receptor in this subfamily .

Genomic Organization

The CX3CR1 gene is located on the short arm of chromosome 3 at position p22.2 in humans . The gene structure is composed of four exons, with only one containing the coding region, and three intronic elements . Expression of the genomic sequence is regulated via three distinct promoters, allowing for tissue-specific expression patterns . This genomic organization contributes to the complex regulation of CX3CR1 expression in various cell types and tissues.

Genetic Variants

Two missense mutations in the CX3CR1 gene, representing single nucleotide polymorphisms (SNPs), have been identified and are responsible for functional changes in the protein . These genetic variations affect the receptor's activity and have been associated with altered susceptibility to various diseases, including age-related macular degeneration (ARMD12), coronary heart disease susceptibility (CHDS1), and HIV susceptibility (HIVS) . The specific effects of these polymorphisms on receptor function include alterations in ligand binding affinity and signal transduction efficiency.

Expression Pattern

CX3CR1 is expressed by various cell types from both hematopoietic and non-hematopoietic lineages throughout the body . Key immune cells expressing CX3CR1 include neutrophils, monocytes, macrophages, dendritic cells, T lymphocytes, and natural killer cells . Expression is also found in vascular endothelial cells, Kupffer cells, hepatic stellate cells, and various cells in the central nervous system . The expression pattern is tissue-specific and varies depending on the physiological or pathological state of the tissue, providing a broad sphere of biological activity for the receptor.

CX3CL1/Fractalkine as the Specific Ligand

CX3CR1 binds exclusively to CX3CL1 (fractalkine in humans, neurotactin in mice), establishing a monogamous receptor-ligand relationship unusual in the chemokine system . CX3CL1 is a unique chemokine possessing a CX3C motif with three amino acids between two conserved cysteines . Unlike other chemokines, CX3CL1 exists in two forms: a membrane-bound form (mCX3CL1) functioning as an adhesion molecule and a soluble form (sCX3CL1) released through proteolytic cleavage by metalloproteinases that mediates chemotaxis .

Signaling Pathways

When CX3CR1-expressing cells are activated by CX3CL1, multiple signaling pathways are initiated. These include activation of hypoxia-inducible factor (HIF)-1α and mitogen-activated protein kinase (MAPK) in endothelial cells . CX3CR1 signaling in monocytes enhances the expression of anti-apoptotic factor B-cell lymphoma 2 (Bcl2), promoting cell survival . The receptor's engagement also leads to increased production of vascular endothelial growth factor (VEGF) in certain cell types, contributing to angiogenesis . These diverse signaling pathways demonstrate the multifunctional nature of CX3CR1 in various cellular processes.

Expression Systems for Recombinant Production

Recombinant human CX3CR1 protein can be produced using various expression systems including wheat germ, Escherichia coli (E. coli), and human embryonic kidney 293 (HEK-293) cells . Each expression system offers distinct advantages in terms of protein folding, post-translational modifications, and functional activity. Wheat germ expression systems provide a eukaryotic environment for protein production while avoiding some of the challenges associated with mammalian cell culture . HEK-293 cells offer a human cellular environment that can achieve more native-like post-translational modifications, while E. coli systems typically yield higher protein quantities though may require additional refolding steps .

Protein Tags and Purification Strategies

Recombinant CX3CR1 proteins are typically produced with fusion tags to facilitate purification and detection. Common tags include glutathione S-transferase (GST), polyhistidine (His), and Fc tags . These tags serve multiple purposes: enhancing protein solubility, enabling affinity-based purification, and providing detection epitopes for analytical methods. The choice of tag depends on the intended application, with consideration for potential effects on protein structure and function. Purification methods vary according to the expression system and tag, with affinity chromatography being commonly employed to achieve high purity.

Research Applications

Recombinant human CX3CR1 protein serves numerous research applications including western blotting (WB), enzyme-linked immunosorbent assay (ELISA), affinity purification (AP), and antibody array (AA) techniques . These applications enable the study of receptor-ligand interactions, identification of novel binding partners, development of targeted therapies, and investigation of signaling pathways. The availability of recombinant CX3CR1 with various tags and from different expression systems provides researchers with flexible options to address specific experimental needs and research questions.

Role in Immune System

CX3CR1-expressing immune cells play pivotal roles in both pro-inflammatory and anti-inflammatory responses depending on the environmental conditions . The receptor mediates recruitment of immune cells to sites of inflammation, facilitates adhesion to endothelial cells, and regulates immune cell survival. In rheumatoid arthritis, increased CX3CL1 expression contributes to the infiltration of inflammatory cells expressing CX3CR1 into affected joints, including macrophages, dendritic cells, and T cells . Studies with CX3CR1-deficient mice demonstrated decreased inflammation in experimental arthritis models, highlighting the receptor's pro-inflammatory role in this context .

Cardiovascular Functions

In the cardiovascular system, CX3CR1 is expressed in vascular endothelial cells and monocytes/macrophages, where it plays critical roles in angiogenesis and vascular remodeling . During ischemic conditions, human CD14+ monocytes expressing CX3CR1 contribute to the formation of extracellular matrix and vascular remodeling by producing cytokines and growth factors involved in angiogenesis . The CX3CR1 signaling pathway enhances the expression of vascular endothelial growth factor, thereby promoting cellular proliferation and formation of new blood vessels . The receptor also participates in atherosclerosis development through its effects on monocyte adhesion and survival.

Role in Liver Function and Pathology

CX3CR1 expression is upregulated in chronic inflammatory liver conditions such as viral hepatitis . In acute hepatic damage, CX3CR1-expressing Kupffer cells, liver-infiltrating lymphocytes, biliary epithelial cells, and hepatic stellate cells all contribute to necrosis and inflammation . The receptor plays a dual role in liver pathology: it can limit liver fibrosis by controlling differentiation and survival of intrahepatic monocytes, but it also mediates essential survival signals for hepatic monocyte-derived macrophages by activating anti-apoptotic Bcl2 expression . CX3CL1-CX3CR1 interaction can inhibit inflammatory properties in Kupffer cells/macrophages, resulting in decreased liver inflammation and fibrosis in certain contexts .

Role in Inflammatory Diseases

CX3CR1 is implicated in various inflammatory diseases including rheumatoid arthritis, where blockade of CX3CL1 by a monoclonal antibody significantly reduces synovial inflammation and joint bone loss in experimental models . In granulomatosis with polyangiitis (previously known as Wegener's granulomatosis), CX3CR1 expressed in peripheral blood mononuclear cells promotes inflammation by facilitating leukocyte migration into inflammatory lesions . The receptor is also involved in primary biliary cirrhosis, an autoimmune condition caused by chronic inflammation of Th1/Th17 cells, where CX3CL1 expression correlates significantly with disease progression .

Implications in Vascular Disorders

The CX3CR1-CX3CL1 axis plays a significant role in vascular disorders, including atherosclerosis and ischemic conditions. CX3CR1 deficiency can reduce monocyte binding to injured endothelium, resulting in decreased adherence and potentially reduced atherosclerotic plaque formation . The receptor provides survival signals for monocytes through anti-apoptotic factor Bcl2 expression, which is required for monocyte homeostasis and contributes to arteriosclerosis development . Understanding these mechanisms has potential implications for developing therapies targeting cardiovascular diseases.

Involvement in HIV Infection

CX3CR1 has been identified as a coreceptor, along with CD4, for the envelope protein from primary isolates of HIV-1 in cell-cell fusion assays . This interaction is specifically inhibited by fractalkine, the natural ligand of CX3CR1 . The receptor's role in HIV infection highlights its potential as a target for antiviral strategies. Additionally, genetic polymorphisms in the CX3CR1 gene have been associated with altered susceptibility to HIV infection (HIVS), further emphasizing the receptor's relevance in this context .

Therapeutic Potential

The specific interaction between CX3CR1 and its ligand CX3CL1 presents an attractive target for therapeutic intervention in various inflammatory and immune-mediated conditions. Blockade of the CX3CL1-CX3CR1 axis has shown promise in experimental models of rheumatoid arthritis, suggesting potential applications in treating inflammatory joint diseases . The receptor's role in vascular disorders, liver fibrosis, and HIV infection also highlights potential therapeutic avenues. Development of specific antagonists, neutralizing antibodies, or small molecule inhibitors targeting CX3CR1 represents an active area of research with promising therapeutic implications.

Diagnostic Applications

Recombinant CX3CR1 proteins are valuable tools for developing diagnostic assays to detect alterations in CX3CR1 expression or function associated with various pathological conditions. These proteins can be incorporated into antibody arrays, ELISAs, and other immunoassay formats to assess receptor levels in biological samples . Given the receptor's involvement in multiple disease processes, such diagnostic applications could aid in early disease detection, monitoring disease progression, and evaluating therapeutic responses. The availability of recombinant CX3CR1 with various tags facilitates the development and optimization of these diagnostic platforms.

Emerging Research Areas

Recent research has expanded our understanding of CX3CR1's roles beyond traditional immune and inflammatory functions. Emerging areas of investigation include the receptor's involvement in neural development and function, tumor immunology, and metabolic disorders. The tissue-specific expression and functional diversity of CX3CR1 continue to reveal new biological roles and potential applications. Advanced techniques such as CRISPR-Cas9 gene editing, single-cell analysis, and high-throughput screening are being employed to further elucidate the receptor's functions and identify novel therapeutic targets within its signaling network.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CX3CR1; CMKBRL1; GPR13; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; Beta chemokine receptor-like 1; CMK-BRL-1; CMK-BRL1; Fractalkine receptor; G-protein coupled receptor 13; V28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Uniprot No.

Target Background

Function
CX3CR1 is a receptor for the C-X3-C chemokine fractalkine (CX3CL1), expressed on various early leukocyte cells. CX3CR1-CX3CL1 signaling plays distinct roles in different tissue compartments, including immune response, inflammation, cell adhesion, and chemotaxis. CX3CR1-CX3CL1 signaling mediates cell migration. It is involved in the recruitment of natural killer (NK) cells to inflamed tissues. CX3CR1-CX3CL1 signaling regulates the inflammatory process during atherogenesis by mediating macrophage and monocyte recruitment to inflamed atherosclerotic plaques, promoting cell survival. It contributes to airway inflammation by promoting interleukin 2-producing T helper (Th2) cell survival in the inflamed lung. CX3CR1-CX3CL1 signaling is also involved in the migration of circulating monocytes to non-inflamed tissues, where they differentiate into macrophages and dendritic cells. It acts as a negative regulator of angiogenesis, likely by promoting macrophage chemotaxis. CX3CR1-CX3CL1 signaling plays a crucial role in brain microglia by regulating inflammatory responses in the central nervous system (CNS) and synapse maturation. It is essential for restraining the microglial inflammatory response in the CNS and preventing parenchymal damage in response to pathological stimuli. CX3CR1-CX3CL1 signaling contributes to brain development by participating in synaptic pruning, a process where brain microglia eliminate extra synapses during postnatal development. Synaptic pruning by microglia is necessary for promoting the maturation of circuit connectivity during brain development. CX3CR1-CX3CL1 signaling serves as a vital regulator of the gut microbiota by controlling immunity to intestinal bacteria and fungi. It is expressed in lamina propria dendritic cells in the small intestine, which form transepithelial dendrites capable of taking up bacteria to provide defense against pathogenic bacteria. CX3CR1-CX3CL1 signaling is required to initiate innate and adaptive immune responses against the dissemination of commensal fungi (mycobiota) in the gut. It is expressed in mononuclear phagocytes (MNPs) and promotes the induction of antifungal IgG antibody responses to confer protection against disseminated C.albicans or C.auris infection. CX3CR1-CX3CL1 signaling also functions as a receptor for the C-C motif chemokine CCL26, inducing cell chemotaxis.

CX3CR1 is involved in microbial infection by acting as a coreceptor with CD4 for HIV-1 virus envelope protein.
Gene References Into Functions
  1. Study demonstrated that CX3CL1/CX3CR1 was overexpressed in prostate cancer tissues with spinal metastasis compared with primary tumors. Overexpression of CX3CR1 increased cell proliferation, migration, and invasion. The study also observed that the EGFR/Src/FAK pathway was activated by CX3CL1/CX3CR1. PMID: 30066854
  2. CX3CR1 major allele carriers V249 and T280 are significantly associated with an increased total arterial blood volume of the whole brain, particularly around the bilateral precuneus, left posterior cingulate cortex, and left posterior parietal cortex. PMID: 29485193
  3. An investigation explored the association of CX3CR1 839C/T, CX3CR1 745G/A, polymorphisms with Age-Related Macular Degeneration (AMD) risk. These polymorphisms were associated with an increased AMD risk (CX3CR1 839C/T, additive model: aOR=2.682, 95% CI=1.119-5.709, P=0.022, recessive model: aOR=2.729, 95% CI=1.141-6.048, P=0.010; CX3CR1 745G/A, additive model: aOR=2.614, 95% CI=1.231-6.012, P=0.020, recessive model: aOR=2.340, 95% CI=1.227-5.993, P=0.011 PMID: 29565837
  4. CX3CR1 regulated chondrocyte proliferation. PMID: 29217163
  5. A statistically significant association was detected between the variant Ala55Thr in CX3CR1 with schizophrenia and autism spectrum disorder phenotypes PMID: 28763059
  6. This study showed that CX3CR1 expression in both Microglia and Astrocytes in the hippocampus is affected by stroke, Alzheimer's disease, and Lewy body dementia. PMID: 28398520
  7. The US28 gene product has maintained the function of the ancestral gene and has the ability to bind and signal in response to human CX3CL1, the natural ligand for CX3CR1. PMID: 28315475
  8. Findings demonstrate that motility, invasion, and contact-independent growth of PDAC cells all increase following CX3CL1 exposure. Antagonism of CX3CR1 by the inhibitor JMS-17-2 reduces each of these phenotypes and correlates with a downregulation of AKT phosphorylation. PMID: 29274778
  9. In Crohn's disease patients, a missense mutation in the gene encoding CX3CR1 was identified and found to be associated with impaired antifungal responses PMID: 29326275
  10. Soluble FKN, efficiently shed from the surface of LPS-activated ECs in response to binding of CD16(+) monocytes to ECs, diminished monocyte adhesion by down-regulating CX3CR1 expression on the surface of CD16(+) monocytes, resulting in decreased TNF-secretion. PMID: 27031442
  11. CX3CR1 genetic variants were not associated with the risk of atherosclerotic coronary heart disease and glucometabolic traits in a European ancestry cohort. In a South Asian cohort, a CX3CR1 SNP associated with myocardial infarction and type II diabetes mellitus was identified. PMID: 27013693
  12. FKN and CX3CR1 expression was significantly increased in pancreatic ductal adenocarcinoma (PDAC) tissues, particularly in metastatic samples, and was highly correlated with the severity of PDAC. Ectopic expression of FKN promoted PDAC proliferation and migration, while knockdown of CX3CR1 reversed the effects of FKN. PMID: 28986258
  13. CX3CL1 is upregulated in both human and murine tumors following VEGF signaling blockade, leading to the recruitment of CX3CR1+Ly6Clo monocytes into the tumor PMID: 28691930
  14. Fractalkine functions by activating the AKT/NF-kappaB/p65 signaling cascade and regulating the antiapoptosis process in pancreatic cancer cells. PMID: 28845524
  15. High expression of CX3CR1 correlates with significantly shorter survival, particularly in post-menopausal patients with advanced and terminal stages of epithelial ovarian carcinoma. This supports a key regulatory role for the fractalkine axis in advanced and relapsed peritoneal metastasis in epithelial ovarian carcinoma. PMID: 27941884
  16. rs3732378 and rs3732379 susceptibility loci for developmental dysplasia of the hip PMID: 27176135
  17. The V249I genotype of the fractalkine receptor showed a protective role in patients with type 2 diabetes. The T280M genotype is associated with increased carotid intima-media thickness in Mexican individuals with or without type 2 diabetes PMID: 28128806
  18. CX3CR1 genetic variation suggests a possible association with hypertension, diabetes mellitus, and atherosclerosis comorbidities in patients undergoing hemodialysis. PMID: 27118566
  19. This study shows that the expression of CX3CR1 on tonsillar CD8-positive cells is higher in IgA nephropathy patients PMID: 28196748
  20. Low CCRL1 expression is associated with hepatocellular carcinoma. PMID: 26813566
  21. Recent studies indicate that, in allergic diseases, there is an increased expression of fractalkine/CX3CL1 and its unique receptor CX3CR1, and this chemokine does not act as a chemoattractant. In allergic asthma, CX3CR1 expression regulates Th2 and Th1 cell survival in the inflamed lung, while, in atopic dermatitis, it regulates Th2 and Th1 cell retention in the inflammatory site. [review] PMID: 27011244
  22. cxc3cr1 is a biomarker for Alzheimer's disease. PMID: 26567742
  23. CX3CR1 is expressed in the normal, cancer adjacent normal, inflammatory, and malignant fallopian epithelium. PMID: 26633537
  24. Genetic polymorphism is associated with delayed allograft function in Polish kidney transplant recipients PMID: 25898802
  25. The CX3CR1 T allele of rs3732379 might have a positive association with the susceptibility of age-related macular degeneration PMID: 26464724
  26. CX3CR1 is expressed differentially in human monocytes during differentiation. PMID: 25502213
  27. This meta-analysis suggested that CX3CR1 T280M and V249I polymorphisms may not be associated with an increased risk of AMD based on current published data. PMID: 26651305
  28. Data show that fractalkine receptor CX3CR1 expression is decreased in both murine and human glioblastoma (GBM) tissue. PMID: 25987130
  29. Respiratory syncytial virus G protein and host CX3CR1 interaction is important in infection and infection-induced responses of the airway epithelium. PMID: 26297201
  30. Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease PMID: 26123579
  31. Specific pro-inflammatory monocyte subpopulations positive for CD16 and the co-expressed chemokine receptor, CX3CR1, are discriminative for chronic kidney disease stage 5 on hemodialysis patients. PMID: 25830914
  32. CX3CR1 is expressed in differentiated human ciliated airway cells and co-localizes with respiratory syncytial virus on cilia in a G protein-dependent manner. PMID: 26107373
  33. CX3CL1 and CX3CR1 may contribute to the formation of coronary atherosclerotic plaque in coronary artery disease PMID: 25845619
  34. Fractalkine receptor polymorphisms may not contribute to the molecular pathogenesis of ulcerative colitis. PMID: 26042517
  35. The results from the present study support the concept of CX3CL1-mediated activation of the progression of multiple myeloma via CX3CR1. PMID: 25962684
  36. This is the first demonstration of the role of DNA methylation in regulating the expression of the CX3CR1 gene by CD8+ T cells and the potential biological relevance of increased expression of CX3CR1 by IL-7Ra(low) effector memory CD8+ T cells in humans. PMID: 26276874
  37. The study found a significantly lower expression of CX3CR1 on CD8+ T cells in the neovascular age-related macular degeneration group compared to the control group (p = 0.04). PMID: 25503251
  38. The high expression of CX3CR1 was associated with prolonged isolated thrombocytopenia after allogeneic hematopoietic stem cell transplantation. PMID: 26141368
  39. The progression rate of ALS symptoms and survival time is affected in patients with one or two copies of the CX3CR1 249I allele. CX3CR1 is the most potent ALS survival genetic factor reported to date PMID: 24806473
  40. An inverse pattern was observed in gene expression levels of fractalkine receptor (CX3CR1), which might be a compensatory mechanism. PMID: 24930044
  41. Findings suggest that overexpression of CX3CR1 promotes gastric cancer metastasis, proliferation, and survival and might play a physiological role in normal gastric tissue renewal and/or tissue remodeling after injury. PMID: 25482732
  42. Fractalkine and CX3CR1 may play a role in the pathogenesis of pSS, including extraglandular manifestations. PMID: 25320221
  43. Cx3cr1-deficient mononuclear phagocytes express increased P2X7 receptors, which stimulates IL-1Beta secretion. PMID: 25948251
  44. A higher percentage of circulating CD4(+) T-cells expressed CX3CR1 in relapsing-remitting multiple sclerosis compared to healthy controls. PMID: 25596452
  45. Data show that the chemokine domain of fractalkine (FKN-CD) can activate alphavbeta3 integrin in the absence of fractalkine receptor CX3CR1, but this activation requires the direct binding of FKN-CD to alphavbeta3. PMID: 24789099
  46. These findings suggest that CCR2, CX3CR1, RANTES, and SDF1 gene variants seem to play a significant role in the dynamics of HIV infection and could be used as drug or vaccine targets. PMID: 25313609
  47. Insulin resistance increases plaque vulnerability by augmenting the CX3CL1/CX3CR1 axis, which is mechanistically linked to reduced vascular smooth muscle cell survival PMID: 24788416
  48. Our results confirm previous findings on the predominance of R5 tropism among HIV-1 treatment-naive subjects and reveal an association between a higher frequency of R5 tropism and the CX3CR1 A allele and a lower additive genetic score. PMID: 24750723
  49. CX3CR1 (T280M and V249I) and PLEKHA1 (A320T) polymorphisms were not found to be associated with age-related macular degeneration in an Indian population. PMID: 25050486
  50. Suggest that CCRL1 impairs chemotactic events associated with CCR7 in the progression and metastasis of hepatocellular carcinoma. PMID: 25255875

Show More

Hide All

Database Links

HGNC: 2558

OMIM: 601470

KEGG: hsa:1524

STRING: 9606.ENSP00000351059

UniGene: Hs.78913

Involvement In Disease
Macular degeneration, age-related, 12 (ARMD12)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in lymphoid and neural tissues. Expressed in lymphocyte subsets, such as natural killer (NK) cells, gamma-delta T-cells and terminally differentiated CD8(+) T-cells. Expressed in smooth muscle cells in atherosclerotic plaques.

Q&A

What is CX3CR1 and what makes it structurally unique?

CX3CR1 stands as the sole member of the CX3C chemokine receptor subfamily and exclusively binds to its endogenous ligand CX3CL1 (fractalkine). Unlike other chemokine receptors that often display promiscuity in ligand binding, CX3CR1 demonstrates remarkable specificity. Structurally, CX3CR1 has been resolved using cryo-electron microscopy at 2.8Å (ligand-free state) and 3.4Å (CX3CL1-bound state), revealing crucial insights into its conformational changes upon activation . These structures show that CX3CR1 couples to Gi proteins and undergoes specific conformational changes upon ligand binding, particularly in the extracellular regions where the N-terminus moves closer to the center axis of the helical bundle while the extracellular loop 2 (ECL2) is pushed outward .

What primary signaling pathways are activated by CX3CR1?

CX3CR1 predominantly couples to Gi proteins upon activation, triggering multiple downstream signaling cascades. When activated, CX3CR1 mediates several critical cellular processes including chemotaxis, cell migration, angiogenesis, and apoptosis resistance . Recent structural studies have revealed that the activation of CX3CR1 involves smaller conformational changes in helix VI compared to other G protein-coupled receptors (GPCRs), which may be stabilized by three cholesterol molecules that play essential roles in conformation maintenance and signal transduction . Methodologically, researchers can investigate these pathways through phosphorylation analysis of downstream effectors, calcium mobilization assays, and ERK activation studies.

How does CX3CR1 interact with its ligand CX3CL1?

The interaction between CX3CR1 and CX3CL1 involves specific molecular recognition mechanisms. Structurally, key residues in the receptor binding pocket are crucial for ligand recognition. Particularly important are two acidic residues: E254 (position 6.58), which forms a salt bridge with H3 of CX3CL1, and E279 (position 7.39), which forms extensive polar interactions with H2 and the main chain of G4-V5 of CX3CL1 . Functional studies using site-directed mutagenesis demonstrate that altering E254 to alanine severely impairs both CX3CL1 binding and CX3CR1 activation, whereas substituting it with glutamine or aspartic acid restores signaling to levels comparable with the wild-type receptor . This highlights the importance of these electrostatic interactions in receptor-ligand recognition.

What experimental models are most effective for studying CX3CR1 function?

Researchers commonly employ several models to investigate CX3CR1 function, each offering distinct advantages. CX3CR1 knockout mice (CX3CR1-/-) have proven invaluable for studying the receptor's role in various physiological and pathological contexts. These models have been particularly useful in studying sleep deprivation effects on cognitive function, where knockout mice demonstrate different microglial responses and cytokine expression profiles compared to wild-type counterparts .

For structural studies, researchers have successfully utilized recombinant CX3CR1-G protein complexes analyzed via cryo-electron microscopy, achieving resolutions of 2.8Å and 3.4Å for ligand-free and CX3CL1-bound states, respectively . Cell-based assays employing CX3CR1-expressing cell lines (often THP-1 cells or primary monocytes) allow for investigation of binding kinetics, signaling, and functional responses such as chemotaxis or adhesion to endothelial cells . When designing experiments, researchers should consider the specific aspect of CX3CR1 biology being investigated to select the most appropriate model system.

How can researchers effectively measure CX3CR1-CX3CL1 binding kinetics?

Multiple complementary approaches can be employed to assess CX3CR1-CX3CL1 binding:

  • Radioligand binding assays: Using 125I-labeled CX3CL1 to determine dissociation constants (Kd) and binding capacities.

  • Surface plasmon resonance (SPR): Provides real-time binding kinetics without radioactive labels, revealing association (ka) and dissociation (kd) rates.

  • FRET/BRET-based assays: Allow monitoring of receptor-ligand interactions in living cells, providing spatial and temporal resolution.

  • Cross-linking experiments: As demonstrated in structural studies, chemical cross-linking followed by mass spectrometry can identify specific interaction sites within the CX3CR1-CX3CL1 complex .

  • Computational docking and molecular dynamics: These approaches complement experimental data by predicting binding modes and interaction energies.

When conducting binding studies, it is crucial to validate findings using multiple methodologies, as each technique has inherent limitations and strengths.

How does CX3CR1 modulate microglial function and neuroinflammation?

CX3CR1 plays a pivotal role in regulating microglial activation and neuroinflammatory responses. The CX3CL1/CX3CR1 signaling axis represents a key communication pathway between neurons (which primarily express CX3CL1) and microglia (which express CX3CR1). In vitro studies have demonstrated that CX3CL1 can protect neurons in lipopolysaccharide-activated microglia by reducing pro-inflammatory factor levels .

Interestingly, blocking the CX3CL1/CX3CR1 signaling axis through CX3CR1 knockout has produced context-dependent effects. Research using CX3CR1-/- mice subjected to sleep deprivation showed markedly decreased microglial density in the dentate gyrus, reduced expression of pro-inflammatory cytokines, decreased microglial phagocytosis-related factors, and increased levels of anti-inflammatory cytokines in the hippocampus . These findings suggest that CX3CR1 mediates microglial overactivation during sleep deprivation, and its absence may be protective in this specific context.

Methodologically, researchers can assess microglial activation through immunohistochemical analysis of markers like Iba-1, quantification of cytokine expression profiles via ELISA or PCR, and functional assays of microglial phagocytosis.

What is the relationship between CX3CR1 and cognitive dysfunction in sleep disorders?

The relationship between CX3CR1 and cognitive dysfunction in sleep disorders involves complex neuroimmune interactions. Research using CX3CR1-/- mice subjected to sleep deprivation (SD) has provided valuable insights into this relationship. When compared to sleep-deprived wild-type mice, CX3CR1-/- mice show significantly different responses to SD, including altered microglial activation patterns and cytokine profiles in the hippocampus .

A notable finding is that CX3CR1-/- mice subjected to SD show increased expression of BDNF (Brain-Derived Neurotrophic Factor) and enhanced CREB phosphorylation compared to their non-sleep-deprived counterparts . These molecular changes correlate with preservation of dendritic spine density in the dentate gyrus and potentially reduced cognitive impairment. The mechanism appears to involve modulation of microglial activation, as CX3CR1-/- mice show decreased microglial density in the dentate gyrus following sleep deprivation, suggesting that CX3CR1 deficiency may attenuate the microglial overactivation typically observed in this condition .

This research indicates that CX3CR1 may be a potential therapeutic target for preventing cognitive dysfunction associated with sleep disorders, particularly through its effects on neuroinflammation and synaptic plasticity.

How does CX3CR1 contribute to kidney disease pathogenesis?

CX3CR1 plays a significant role in kidney disease through several mechanisms. In models of glomerulonephritis, both CX3CL1 and CX3CR1 expression are increased, with CX3CL1 being induced on glomerular endothelium while CX3CR1 is expressed on infiltrating T-cells and macrophages . These CX3CR1-positive cells demonstrate chemotaxis toward CX3CL1 gradients, mediating inflammatory cell recruitment.

The pathogenic importance of this pathway is underscored by intervention studies showing that daily treatment with anti-CX3CR1 antibodies results in attenuated disease severity in experimental glomerulonephritis . In human renal biopsies from patients with crescentic glomerulonephritis, CX3CL1 expression increases during active disease and decreases following steroid treatment, suggesting clinical relevance .

CX3CR1 also plays a critical role in ischemia-reperfusion injury (IRI) of the kidney. Studies demonstrate that CX3CR1 deficiency is protective against renal impairment after IRI and reduces infiltration of monocyte-derived macrophages into the renal parenchyma . This protection is reversed after adoptive transfer of CX3CR1-competent blood monocytes, confirming that CX3CR1-dependent macrophage migration contributes to kidney injury .

These findings suggest that targeting the CX3CL1-CX3CR1 axis could be a promising therapeutic approach for various kidney diseases.

What methodologies are most effective for evaluating CX3CR1 involvement in inflammatory diseases?

Multiple complementary approaches can effectively assess CX3CR1's role in inflammatory conditions:

  • Expression analysis: Quantifying CX3CR1 levels in affected tissues using immunohistochemistry, flow cytometry, or PCR. Comparative analysis between healthy and diseased tissues provides insight into receptor upregulation during pathological states.

  • Genetic approaches: Utilizing CX3CR1 knockout models (global or conditional) to determine the receptor's necessity in disease progression. These can be complemented with bone marrow chimeras to distinguish between the roles of CX3CR1 on circulating versus tissue-resident cells.

  • Pharmacological interventions: Testing anti-CX3CR1 antibodies or small molecule antagonists in disease models. For example, studies have shown that daily treatment with anti-CX3CR1 antibodies attenuates disease severity in experimental glomerulonephritis .

  • Cell migration assays: Assessing chemotaxis of CX3CR1-positive cells isolated from inflamed tissues toward CX3CL1 gradients. This approach has confirmed that cells from inflamed kidneys remain responsive to CX3CL1-mediated migration .

  • Adoptive transfer experiments: Transferring CX3CR1-competent or CX3CR1-deficient cells into recipient animals to determine the contribution of CX3CR1 on specific cell populations. This approach has demonstrated that CX3CR1-competent monocytes can restore kidney injury in otherwise protected CX3CR1-deficient mice .

A comprehensive investigation should employ multiple methodologies to establish both correlation and causation in the relationship between CX3CR1 and inflammatory disease processes.

How do cholesterol molecules affect CX3CR1 conformation and signaling?

Recent structural studies of CX3CR1 have revealed the critical role of cholesterol in regulating receptor conformation and signaling. Cryo-electron microscopy structures show that CX3CR1 exhibits a smaller conformational change of helix VI upon activation compared to previously solved class A GPCR-G protein complex structures . This distinctive conformational characteristic appears to correlate with the presence of three cholesterol molecules that interact with the receptor .

These cholesterol molecules play essential roles in both stabilizing the receptor's conformation and modulating signal transduction. The precise positioning of these cholesterol molecules likely influences the receptor's ability to undergo conformational changes required for G protein coupling and activation. This structural insight helps explain how membrane composition can affect receptor function and provides potential targets for therapeutic intervention.

Methodologically, researchers investigating cholesterol's effects on CX3CR1 can employ cholesterol depletion/repletion experiments, site-directed mutagenesis of cholesterol-interacting residues, and molecular dynamics simulations to further elucidate these structure-function relationships.

What are the key considerations for developing selective CX3CR1 antagonists?

Developing selective CX3CR1 antagonists requires careful consideration of several key factors:

  • Structural insights: The recent cryo-EM structures of CX3CR1 in both ligand-free and CX3CL1-bound states provide crucial information for rational drug design . These structures reveal key binding pocket residues, particularly E254 and E279, which form important interactions with CX3CL1 .

  • Binding site specificity: Antagonists must specifically target CX3CR1 without affecting other chemokine receptors. The unique structural features of CX3CR1's binding pocket should be exploited to achieve selectivity.

  • Functional assays: Development pipeline should include multiple functional readouts of CX3CR1 activity, including G protein coupling, β-arrestin recruitment, and downstream signaling events.

  • Translational considerations: Given CX3CR1's therapeutic potential in atherosclerosis, cancer, and neuropathy , antagonists should be evaluated in disease-relevant models that recapitulate human pathology.

  • Consideration of cholesterol interactions: As three cholesterol molecules play essential roles in CX3CR1 conformation stabilization and signaling transduction , antagonist design should consider how compounds might alter these interactions.

Researchers should employ an iterative approach combining computational modeling, medicinal chemistry optimization, and rigorous biological testing to develop potent and selective CX3CR1 antagonists with therapeutic potential.

How do post-translational modifications regulate CX3CR1 function?

Post-translational modifications (PTMs) significantly impact CX3CR1 function through multiple mechanisms. Although specific details about CX3CR1 PTMs are still being elucidated, several regulatory processes likely apply based on studies of related chemokine receptors:

  • Phosphorylation: Likely occurs on serine/threonine residues in the C-terminal tail and intracellular loops, potentially mediating receptor desensitization and internalization. Researchers should employ phospho-specific antibodies and mass spectrometry to map phosphorylation sites and correlate them with functional outcomes.

  • Glycosylation: N-linked glycosylation of extracellular domains may affect ligand binding affinity and receptor stability. Enzymatic deglycosylation experiments combined with binding studies can assess the functional impact of these modifications.

  • Ubiquitination: May regulate receptor degradation and recycling. Immunoprecipitation followed by ubiquitin-specific Western blotting can detect these modifications.

  • Palmitoylation: Cysteine residues in the C-terminal region may undergo palmitoylation, affecting receptor localization and signaling. Metabolic labeling with palmitate analogs can help identify these sites.

Understanding these modifications is methodologically challenging but critical for comprehending the complete regulatory landscape of CX3CR1 signaling, potentially revealing new therapeutic targets and explaining context-dependent receptor functions.

What experimental approaches can elucidate the role of CX3CR1 in neuron-microglia communication?

Investigating neuron-microglia communication through CX3CR1 requires sophisticated experimental approaches:

  • Cell-specific genetic manipulation: Conditional knockout or knockdown of CX3CR1 specifically in microglia (using Cx3cr1-Cre or tamoxifen-inducible Cx3cr1-CreERT2 lines) allows precise interrogation of microglial-specific effects.

  • Live imaging techniques: Two-photon microscopy of fluorescently labeled microglia in Cx3cr1GFP/+ mice enables real-time visualization of microglial dynamics and responses to neuronal activity or injury.

  • Microglia-neuron co-culture systems: These allow for controlled manipulation of the CX3CL1/CX3CR1 axis and assessment of effects on both cell types. Parameters to measure include microglial morphology, motility, phagocytic activity, and neuronal viability.

  • Single-cell transcriptomics: This approach can reveal cell-specific responses to CX3CR1 activation or deletion, identifying downstream pathways and feedback mechanisms.

  • Synaptic pruning assays: Given CX3CR1's involvement in synaptic pruning , methods to quantify microglial engulfment of synaptic material (e.g., using pH-sensitive fluorescent tags) are valuable for understanding this process.

  • Electrophysiological recordings: These can assess how CX3CR1-mediated microglial functions affect neuronal activity and synaptic transmission.

Research has shown that CX3CL1 can influence both the number and function of microglia, affecting synaptic pruning and cognitive function . The interaction between neuron-secreted CX3CL1 and microglial CX3CR1 represents a key communication axis, and these methodologies can help elucidate its multifaceted roles in health and disease.

Comparative Analysis of CX3CR1 Effects in Different Experimental Models

Experimental ModelCX3CR1 FunctionKey FindingsMethodological ApproachReference
CX3CR1-/- mice with sleep deprivationCognitive functionDecreased microglial density in dentate gyrus, reduced pro-inflammatory cytokines, increased BDNF and p-CREB/CREB ratioBehavioral tests, immunohistochemistry, protein expression analysis
Glomerulonephritis modelsInflammatory cell recruitmentIncreased CX3CL1 on glomerular endothelium, CX3CR1+ infiltrating T-cells and macrophagesAnti-CX3CR1 antibody treatment, chemotaxis assays
Renal ischemia-reperfusion injuryMonocyte/macrophage migrationCX3CR1 deficiency protects against renal impairment, reduces macrophage infiltrationAdoptive transfer experiments, histology, blood urea/creatinine measurement
Cryo-EM structural studiesLigand binding and activationKey residues E254 and E279 mediate CX3CL1 binding, three cholesterol molecules stabilize conformationCryo-electron microscopy, mutagenesis, signaling assays

Therapeutic Targeting Strategies for CX3CR1 in Different Disease Contexts

The development of therapeutic strategies targeting CX3CR1 shows promise across multiple disease contexts:

  • Neurological disorders: CX3CR1 modulates microglial activation and neuroinflammation, making it a potential target for conditions like Alzheimer's disease, Parkinson's disease, and cognitive dysfunction associated with sleep disorders .

  • Kidney diseases: Anti-CX3CR1 antibody treatment attenuates disease severity in experimental glomerulonephritis and ischemia-reperfusion injury models, suggesting therapeutic potential in acute and chronic kidney diseases .

  • Cardiovascular disease: CX3CR1 contributes to atherosclerosis pathogenesis through monocyte recruitment and foam cell formation, representing an attractive therapeutic target .

  • Cancer: CX3CR1 mediates tumor cell migration, angiogenesis, and apoptosis resistance, indicating potential roles in metastasis and tumor progression .

Effective targeting approaches may include:

  • Monoclonal antibodies against CX3CR1

  • Small molecule antagonists designed based on structural insights

  • RNA interference technologies for transient CX3CR1 suppression

  • Gene editing approaches for permanent modification of CX3CR1 function

Each approach requires careful evaluation of efficacy, specificity, and potential off-target effects in relevant disease models before advancing to clinical development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.