Recombinant Human Cyclic nucleotide-gated cation channel alpha-3 (CNGA3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
CNGA3; CNCG3; Cyclic nucleotide-gated cation channel alpha-3; Cone photoreceptor cGMP-gated channel subunit alpha; Cyclic nucleotide-gated channel alpha-3; CNG channel alpha-3; CNG-3; CNG3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-694
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADS GQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQAN VGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIALPVF YNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLW QHYKTTTQFKLDVLSLVPTDLAYLKVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNM FRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYWST LTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSI KQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKV RIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVV LSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEE KGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQ RLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ
Uniprot No.

Target Background

Function
Visual signal transduction in cone photoreceptors is mediated by a G-protein coupled cascade utilizing cGMP as a second messenger. Cyclic GMP activates this protein, opening cation channels and causing depolarization. Studies have shown that this protein induces flickering channel gating, weakens outward rectification in the presence of extracellular calcium, increases sensitivity to L-cis diltiazem, and enhances cAMP efficacy when co-expressed with CNGB3. It is crucial for generating light-evoked electrical responses in red, green, and blue-sensitive cones.
Gene References Into Functions
  1. Identification of a novel human CNGA3 isoform with an alternative translation initiation site. The functional role of this short isoform remains unclear. PMID: 29499183
  2. Identification of a c.1618G>A, p.Gly540Ser substitution in CNGA3 as the causative mutation for a novel form of achromatopsia (ACHM) in Awassi sheep. Gene augmentation therapy restored vision, establishing a valuable large-animal model for human CNGA3 ACHM. PMID: 28282490
  3. Report of four novel CNGA3 mutations (c.1682G>A;p.G561E, c.139C>T;p.Q47*, c.784G>C;p.A282P, c.1116delC;p.V373*) in achromatopsia patients. PMID: 28159970
  4. Two novel CNGA3 mutations (c.997_998delGA and p.M424V) identified as causes of complete achromatopsia. PMID: 27040408
  5. Identification of c.955T>C, the first CNGA3 variant associated with cone-rod dystrophy phenotype in a large consanguineous Pakistani family. PMID: 25052312
  6. CNGA3 mutations identified as the leading cause of achromatopsia in Israeli and Palestinian patients. Retinal structural findings support the suitability of CNGA3 ACHM for therapeutic trials targeting cone photoreceptors. PMID: 25616768
  7. Identification of ten novel CNGA3 mutations in a cohort of achromatopsia patients. PMID: 25637600
  8. CNGA3 mutations identified as a common cause of cone-rod dystrophies and achromatopsia in the Chinese population. PMID: 24903488
  9. Identification of homozygous mutations in CNGB3 and heterozygous mutations in CNGA3 in patients with complete and incomplete achromatopsia, respectively. PMID: 24676353
  10. Hypothesis that CNGA3 alternative splicing may modulate interactions between cone CNG channels and membrane-bound phosphoinositides. PMID: 24675082
  11. Identification of mutations in CNGB3 and CNGA3 in patients with achromatopsia. PMID: 23362848
  12. Report on the biochemical feedback regulation of CNGA3 mutations in color blindness. PMID: 23677796
  13. Studies supporting a model where intersubunit interactions control the sensitivity of cone CNG channels to phosphoinositide regulation. PMID: 23552282
  14. Identification of five putative disease-causing mutations in ALMS1, IQCB1, CNGA3, and MYO7A in Leber congenital amaurosis patients. PMID: 21901789
  15. Observation of nuclear translocation of apoptosis-inducing factor (AIF) and endonuclease G in CNGA3(-/-)/Nrl(-/-) and CNGB3(-/-)/Nrl(-/-) retinas, suggesting mitochondrial involvement in endoplasmic reticulum stress-activated cell death. PMID: 22493484
  16. Description of a novel S4 motif mutation in CNGA3 in a Pakistani family. PMID: 21912902
  17. Identification of two compound heterozygous mutations (c.829C>T p.R277C and c.1580T>G p.L527R) in CNGA3 in an achromatopsia patient. PMID: 21911670
  18. Discussion of missense, nonsense, splice, and small indel mutations in achromatopsia-associated genes. PMID: 21267001
  19. Report of a case of CNGA3-associated oligocone trichromacy (OT). PMID: 21268679
  20. Identification of three novel CNGA3 mutations (L363P, G367V, and E376K) in the pore-forming region, showing reduced macroscopic currents for G367V and E376K. PMID: 20506298
  21. Haplotype analysis of c.1585G>A indicating a recurrent mutation with a shared Jewish-Muslim founder effect. PMID: 20549516
  22. Identification of two novel mutations in CNGA3 and CNGB3 in Pakistani families with achromatopsia. PMID: 20454696
  23. Discussion of the broader spectrum of cone dysfunction associated with mutations in these genes. PMID: 20079539
  24. Identification of novel CNGA3 missense mutations in achromatopsia patients in the United Kingdom. PMID: 14757870
  25. Importance of the S4 structural motif of CNGA3 for the cellular processing of cone photoreceptor cyclic GMP-gated ion channels. PMID: 15024024
  26. Confirmation of CNGA3 dimer formation and adjacent positioning of like subunits in cone photoreceptors. PMID: 15134637
  27. Identification of 12 (33%) achromatopsia patients with CNGA3 mutations (13 different mutations, including five novel ones). PMID: 15712225
  28. Demonstration that cone dystrophy-associated mutations alter the plasma membrane localization and gating properties of CNGA3 channels. PMID: 15743887
  29. Identification of mutations in CNGA3 and CNGB3 in Hungarian achromatopsia patients. PMID: 16319819
  30. Low frequency (7%, 1/14) of CNGA3 mutations (R436W, L633P) observed in Japanese patients. PMID: 16961972
  31. Modulation of heterologously expressed cone CNG channels by phospholipid metabolism and phosphatidylinositol 3,4,5-trisphosphate. PMID: 17018579
  32. Demonstration that CNGA3 mutations T565M and E593K alter cGMP affinity, causing cone dysfunction and rod monochromacy. PMID: 17693388
  33. Identification of three new CNGA3 mutations in achromatopsia patients. PMID: 18445228
  34. Identification of three novel CNGA3 missense mutations in achromatopsia patients. PMID: 18521937
  35. Identification of two different CNGA3 mutations in United Arab Emirates families with achromatopsia. PMID: 18636117
  36. CNGB3 identified as the most significant causal gene, with T383IfsX13 being the most frequent mutation in complete and incomplete achromatopsia. PMID: 19592100
  37. Discussion of mutations in cone photoreceptor disorders. PMID: 11536077
Database Links

HGNC: 2150

OMIM: 216900

KEGG: hsa:1261

STRING: 9606.ENSP00000272602

UniGene: Hs.234785

Involvement In Disease
Achromatopsia 2 (ACHM2)
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA3 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Prominently expressed in retina.

Q&A

What is the basic structure and functional role of CNGA3 in visual signaling?

CNGA3 encodes the alpha-3 subunit of the cyclic nucleotide-gated (CNG) cation channel that plays a crucial role in cone photoreceptor signal transduction. The channel is composed of transmembrane domains with a cytoplasmic C-terminal region containing the cyclic nucleotide-binding domain . In functional terms, CNGA3 channels facilitate the influx of cations, including calcium, in response to intracellular cGMP binding, which is essential for visual phototransduction in cone cells .

The protein structure features multiple transmembrane segments (S1-S6), with functional domains clustered at specific regions. When expressed alone, CNGA3 can form homomeric channels, but in native cone photoreceptors, it predominantly forms heteromeric channels with the CNGB3 subunit to create fully functional cone photoreceptor channels .

Which biochemical properties characterize CNGA3 channel function?

CNGA3 exhibits several key biochemical functions that define its role in sensory transduction:

  • cGMP binding with high affinity

  • Intracellular cAMP-activated cation channel activity

  • Intracellular cGMP-activated cation channel activity

  • Ligand-gated ion channel activity

Electrophysiological recordings have demonstrated that functional CNGA3/CNGB3 heteromeric channels display a largely linear current-voltage relationship with a single-channel conductance of approximately 41.1 ± 7.8 pS . The channel is selectively inhibited by L-cis-diltiazem (DTZ), which serves as a pharmacological tool for identifying genuine CNGA3/CNGB3 channel activity in experimental systems .

In which signaling pathways does CNGA3 participate?

CNGA3 participates in several critical cellular signaling pathways:

Pathway NameRelated Proteins
Visual signal transduction: ConesARR3, RDH12, GRK7, RLN1
cAMP signaling pathwayHCN2, ROCK2, GPR81, FOS, RRAS, HTR6, ATP1A2, PTGER2, NFKB1, PDE4A
Olfactory transductionOR1A2, OLFR181, OR2A4, OLFR1440, CAMK2B, OLFR146, OLFR502, OLFR493, OR51B2, RGS2

The primary role of CNGA3 is in the visual transduction cascade in cone photoreceptors, where it works in concert with other proteins to convert light stimuli into electrical signals that can be processed by the nervous system .

What types of CNGA3 mutations are associated with visual disorders?

CNGA3 mutations display considerable genetic heterogeneity. The majority (approximately 39 out of 46 known mutations) are missense mutations resulting in amino acid substitutions . Other mutation types include:

  • Stop-codon mutations (4 identified)

  • Small insertions (two 1-bp insertions)

  • In-frame deletions (one 3-bp deletion)

These mutations predominantly affect amino acid residues that are conserved among the cyclic nucleotide-gated (CNG) channel family. They cluster in specific functional regions including:

  • Cytoplasmic face of transmembrane domains S1 and S2

  • Transmembrane domain S4

  • cGMP-binding domain

Several mutations show recurrent patterns, with four specific mutations (R277C, R283W, R436W, and F547L) accounting for 41.8% of all detected mutant CNGA3 alleles .

How can CNGA3 splice variants be characterized, and what is their significance?

Characterization of CNGA3 splice variants requires specialized molecular techniques. A systematic approach involves functional splice assays based on the pSPL3 exon trapping vector . This method allows researchers to analyze how specific nucleotide changes affect the splicing patterns of CNGA3 transcripts.

A comprehensive analysis of 20 CNGA3 splice site variants revealed that ten variants induced aberrant splicing, resulting in 21 different abnormal transcripts . These aberrant splicing events include:

  • Intronic nucleotide retention

  • Exonic nucleotide deletion

  • Complete exon skipping

Eleven of these aberrant transcripts were predicted to introduce premature termination codons, likely resulting in nonsense-mediated mRNA decay or truncated proteins . The functional characterization of these splice variants is critical for reclassifying variants of uncertain significance (VUS) into either likely benign or likely pathogenic categories, with 75% of previously uncertain variants being successfully reclassified through functional analysis .

What methods are most effective for CNGA3 mutation screening?

Effective CNGA3 mutation screening employs a combination of molecular genetic techniques. Based on established protocols, a comprehensive screening approach includes:

  • PCR amplification of all coding exons (exons 1-7) and flanking intron/untranslated sequences from genomic DNA

  • Direct DNA sequencing of both strands for initial identification of variants

  • Single-strand conformation polymorphism (SSCP) analysis for rapid screening of known mutation regions

For more efficient screening in large cohorts, a practical sequential protocol has been established:

  • Initial sequence analysis of exon 7

  • Sequence or SSCP analysis of exons 5 and 6

  • Sequence analysis of all remaining exons (including exons 2b and 0) in patients with only a single heterozygous mutation identified

Additional confirmatory techniques include restriction enzyme digestion analyses using modified primers to create or eliminate restriction sites corresponding to specific mutations .

How do CNGA3 mutations contribute to achromatopsia pathophysiology?

Achromatopsia is predominantly caused by loss-of-function mutations in CNGA3 that impair channel function through various molecular mechanisms. Most characterized missense achromatopsia-associated mutations (AAMs) in CNGA3 produce little or no whole-cell currents when expressed in heterologous systems like HEK293 cells .

The pathophysiological mechanisms of CNGA3 mutations include:

  • Protein misfolding and impaired trafficking to the cell membrane

  • Defective channel gating properties

  • Aberrant posttranslational modifications

  • Enhanced protein turnover and degradation

These defects lead to dysfunctional cone photoreceptor signaling, resulting in the characteristic symptoms of achromatopsia: congenital color blindness, photophobia, reduced visual acuity, and nystagmus .

What is the spectrum of cone disorders associated with CNGA3 mutations?

CNGA3 mutations cause a broader spectrum of cone photoreceptor disorders than initially recognized. While predominantly associated with complete achromatopsia, CNGA3 mutations have been identified in:

  • Complete achromatopsia (most common presentation)

  • Incomplete achromatopsia with residual cone function

  • Progressive cone dystrophy (CD)

A prospective multicenter study of 60 probands with autosomal recessive cone dystrophy found CNGA3 mutations in a small percentage of cases, suggesting that these genes contribute to later-onset progressive cone disorders . These patients typically present with progressive deterioration of visual acuity, color vision, and photopic electroretinogram responses, with symptom onset typically in the second decade of life, rather than congenitally .

How does the genotype-phenotype correlation manifest in CNGA3-related disorders?

The genotype-phenotype correlation in CNGA3-related disorders reveals intriguing complexity. Similar genetic defects can lead to markedly different clinical presentations, suggesting the involvement of genetic modifiers or environmental factors:

  • Homozygous missense mutations (such as p.R403Q) have been found in patients with progressive cone dystrophy, sometimes with additional CNGA3 variants that may have an additive effect

  • The p.Cys319Arg variant in CNGA3 has been associated with juvenile cone-rod dystrophy with maculopathy, demonstrating that CNGA3 mutations can cause more complex retinal phenotypes than previously recognized

These observations indicate that initial cone function can sometimes be spared despite the presence of CNGA3 mutations that typically cause congenital dysfunction . This remains a fascinating research question as to why identical gene defects produce different temporal presentations of cone photoreceptor disorders.

What expression systems are optimal for functional analysis of recombinant CNGA3?

For functional analysis of recombinant CNGA3, heterologous expression systems provide valuable platforms, with HEK293 cells being the most widely used. Specific methodological approaches include:

  • For homomeric channel expression:

    • Transfection with 8 μg of the CNGA3 construct plus 2 μg of CFP plasmid as a transfection marker

  • For heteromeric channel expression:

    • Co-transfection of CNGA3 with CNGB3 constructs to recapitulate native cone CNG channels

When expressing mutant channels, consistent protocols allow for direct comparison with wild-type controls. Advanced expression systems such as mammalian cell lines with inducible expression may provide better control over expression levels for certain applications .

What electrophysiological methods best characterize CNGA3 channel properties?

Electrophysiological characterization of CNGA3 channels requires specialized techniques to assess their function:

How can researchers assess the impact of mutations on CNGA3 trafficking and membrane localization?

Assessing the impact of mutations on CNGA3 trafficking and membrane localization requires cellular and biochemical approaches:

  • Western blotting using antibodies against CNGA3 to quantify total protein expression levels in whole-cell lysates compared to wild-type controls

  • Immunolocalization studies employing:

    • Cell surface biotinylation assays to quantify membrane-localized channels

    • Confocal microscopy with fluorescently tagged constructs to visualize subcellular distribution

    • Co-localization with endoplasmic reticulum or plasma membrane markers

  • Calcium imaging techniques to assess functional channel density at the cell surface by measuring agonist-induced calcium influx

The p.Cys319Arg variant in CNGA3, for example, was shown to cause decreased channel density in the HEK293 cell membrane due to impaired folding and/or trafficking of the CNGA3 protein, demonstrating how these techniques can reveal the primary pathogenic mechanisms of mutations .

How do structural alterations in CNGA3 affect channel gating mechanisms?

Structural studies of CNGA3 channels have provided significant insights into their gating mechanisms. Analysis of an achromatopsia-associated mutation revealed that specific structural alterations can dramatically affect channel function:

The R410W mutation in CNGA3 causes spontaneous channel opening in the absence of cyclic nucleotides, which is not observed in wild-type channels . This gain-of-function effect was demonstrated through patch-clamp recordings showing:

  • 9 out of 58 patches of TAX-4_R421W (the C. elegans ortholog) displayed spontaneous activities

  • 17 out of 60 patches of CNGA3_R410W/CNGB3 showed spontaneous currents in the absence of cGMP

  • No spontaneous activity was observed in wild-type channels

This indicates that the arginine residue at this position is critical for maintaining the closed state of the channel in the absence of ligand, providing valuable insights into the structural basis of channel gating .

What are the current challenges in correlating CNGA3 structure with function?

Current structural and functional characterization of CNGA3 channels faces several challenges:

  • Obtaining high-resolution structures of the complete channel in different conformational states remains technically challenging

  • Structural data from cryo-electron microscopy is advancing our understanding, with recent models achieving resolutions of:

Channel StateResolution (Å)FSC ThresholdMap Sharpening B Factor (Ų)
cGMP-bound2.960.143-143
Apo state3.150.143-127
Mutant3.320.143-116
  • Correlating structural changes with functional consequences requires integrated approaches combining structural biology with electrophysiology, fluorescence spectroscopy, and computational modeling

  • Understanding how CNGA3 interacts with CNGB3 to form heteromeric channels that mimic native cone photoreceptor channels requires further investigation into subunit arrangement and stoichiometry

Addressing these challenges will provide deeper insights into how channel structure dictates function in both normal physiology and disease states.

What emerging therapeutic approaches target CNGA3-related disorders?

While not explicitly detailed in the search results, understanding the molecular mechanisms of CNGA3 dysfunction provides the foundation for developing therapeutic approaches for CNGA3-related disorders. Based on the characterized pathogenic mechanisms, several therapeutic strategies can be envisioned:

  • For mutations affecting protein folding and trafficking: chemical chaperones or pharmacological chaperones that promote proper folding and membrane localization

  • For mutations affecting channel gating: compounds that could modulate channel activity to restore normal function

  • For complete loss-of-function mutations: gene replacement therapies delivering functional copies of CNGA3

  • For splice-affecting mutations: antisense oligonucleotides or similar approaches to correct aberrant splicing

The detailed characterization of the molecular and cellular consequences of CNGA3 mutations provides crucial information for developing targeted therapies for conditions like achromatopsia and cone dystrophies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.