Recombinant Human Cysteine-rich with EGF-like domain protein 1 (CRELD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format preferences in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CRELD1; CIRRIN; UNQ188/PRO214; Protein disulfide isomerase CRELD1; Cysteine-rich with EGF-like domain protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-420
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
CRELD1
Target Protein Sequence
QPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGGGNTAWEEENLSKYKDSETR LVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLKLCCPAGTFG PSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHL VCSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSY ECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYR CICAEGYKQMEGICVKEQIPESAGFFSEMTEDELVVLQQMFFGIIICALATLAAKGDLVF TAIFIGAVAAMTGYWLSERSDRVLEGFIKGR
Uniprot No.

Target Background

Function
Protein disulfide isomerase. Facilitates the trafficking of acetylcholine receptors (AChRs) to the cell membrane.
Gene References Into Functions

CRELD1 Gene Function and Associated Conditions:

  1. The CRELD1 gene plays a significant role in the etiology of atrioventricular septal defect (AVSD) in certain Down syndrome patients. PMID: 29054759
  2. Germline mutations in NKX2-5, GATA4, and CRELD1 genes do not appear linked to congenital heart disease (CHD) in Mexican Down syndrome patients. PMID: 25524324
  3. CRELD1 gene mutations increase the risk of atrioventricular septal defect. PMID: 24927998
  4. Two CRELD1 haplotypes were identified as being associated with AVSD in both Down syndrome and euploid individuals. PMID: 22987595
  5. Deleterious CRELD1 missense mutations are specifically associated with AVSD and not other aspects of heterotaxy. PMID: 22740159
  6. The SNP c.985 C>T in CRELD1 is implicated in congenital heart disease in patients from Mysore, South India. PMID: 21413875
  7. CRELD1 is suggested to be an AVSD susceptibility gene; mutations may increase the risk of heart defects rather than being the direct cause. PMID: 21080147
  8. CRELD1 may alter RTN3 localization from the endoplasmic reticulum to the plasma membrane, modulating RTN3's apoptotic activity through binding. PMID: 19521671
  9. Missense mutations in CRELD1 are associated with cardiac atrioventricular septal defects. PMID: 12632326
  10. CRELD1 mutations are infrequently found in patients with congenital cardiac septal defects. PMID: 18076106
Database Links

HGNC: 14630

OMIM: 606217

KEGG: hsa:78987

UniGene: Hs.9383

Involvement In Disease
Atrioventricular septal defect 2 (AVSD2)
Protein Families
CRELD family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in fetal lung, liver, kidney, adult heart, brain and skeletal muscle. Weakly expressed in placenta, fetal brain, and adult lung, liver, kidney and pancreas.

Q&A

What is the basic molecular structure and cellular localization of CRELD1?

CRELD1 is a membrane-associated ER-resident protein disulfide isomerase (PDI) that contains cysteine-rich regions with EGF-like domains. The protein is predominantly localized to the endoplasmic reticulum, where it functions as a key mediator of protein folding and assembly . Structurally, CRELD1 contains multiple functional domains that enable its interactions with various client proteins. The gene encodes several isoforms through alternative splicing, with CRELD1A being the most extensively studied variant in model systems such as C. elegans (where the ortholog is called CRLD-1A) .

How is CRELD1 expression regulated across different tissues and developmental stages?

CRELD1 demonstrates ubiquitous expression across multiple tissues, but with notable temporal and spatial regulation during development. In embryonic tissues, CRELD1 expression is particularly pronounced in developing cardiac structures, especially in endocardial cushions, which aligns with its critical role in atrioventricular septum formation .

Transcriptomic analyses of healthy human populations have revealed significant variance in CRELD1 expression levels even among healthy individuals, which correlates with specific immune parameters like naïve T cell populations . This natural variation has provided valuable insight into CRELD1's physiological functions. Developmental regulation of CRELD1 is tightly controlled, with expression patterns shifting during key developmental windows, particularly during heart formation and immune system maturation.

Experimentally, researchers can monitor CRELD1 expression using quantitative PCR, western blotting with specific antibodies, or RNA sequencing approaches to track tissue-specific and developmental expression patterns.

What are the primary molecular mechanisms through which CRELD1 influences acetylcholine receptor biogenesis?

CRELD1 functions as a maturational enhancer of acetylcholine receptor (AChR) biogenesis through direct physical interaction with AChR subunits in the endoplasmic reticulum . The protein employs its PDI (protein disulfide isomerase) activity to facilitate proper folding and assembly of AChR subunits, particularly for levamisole-sensitive AChRs (L-AChRs).

The molecular process involves several distinct steps:

  • CRELD1 binds to unassembled AChR subunits in the ER

  • It catalyzes the formation of proper disulfide bonds in these subunits

  • This promotes the assembly of multisubunit AChR complexes

  • Properly assembled receptors are subsequently trafficked to the cell surface

Studies in C. elegans demonstrated that crld-1 mutants exhibit decreased sensitivity to levamisole, an AChR agonist, indicating reduced functional receptor expression at the cell surface . The importance of CRELD1's PDI activity was confirmed through rescue experiments where expression of wild-type CRELD1, but not catalytically inactive mutants, restored normal AChR expression and function .

This mechanism appears evolutionarily conserved, as knockdown of Creld1 in mouse muscle cells similarly decreased surface expression of AChRs, and expression of mouse Creld1 rescued phenotypes in C. elegans crld-1 mutants .

How does CRELD1 contribute to ER-mitochondria contact dynamics?

CRELD1 plays a critical role in regulating ER-mitochondria contact sites, which are essential for calcium signaling, lipid transfer, and mitochondrial dynamics. Research indicates that CRELD1 influences these processes through several mechanisms:

  • Regulation of mitochondrial fission: CRELD1 affects the localization of Drp1 (Dynamin-related protein 1), a key mediator of mitochondrial fission. In Creld mutants, the mitochondrial association of Drp1 is reduced to approximately 60% compared to 80% in controls, resulting in decreased fission activity .

  • Calcium signaling: CRELD1 appears necessary for the activation of calcineurin, a calcium-dependent phosphatase that dephosphorylates and activates Drp1. This creates a mechanistic link between CRELD1, calcium homeostasis, and mitochondrial dynamics .

Methodologically, researchers investigating CRELD1's role in ER-mitochondria contacts employ subcellular fractionation techniques to isolate mitochondria-associated ER membranes (MAMs), proximity ligation assays to visualize contact sites, and live-cell imaging with fluorescently tagged proteins to monitor dynamic interactions between these organelles.

What evidence supports CRELD1's role in T cell homeostasis and aging?

Analysis of human population variance in CRELD1 expression has provided compelling evidence for its role in T cell homeostasis. Studies utilizing datasets from the Human Functional Genomics Project (HFGP), the Correlated Expression & Disease Association Research (CEDAR), and the Immune Variation (ImmVar) project revealed that individuals with low CRELD1 expression (bottom 10% of the population) exhibit significantly reduced numbers of naïve peripheral CD4+ T cells and a trend toward reduced naïve CD8+ T cells compared to individuals with high CRELD1 expression (top 10%) .

Experimental validation in conditional CRELD1 knockout mice demonstrated that:

  • Young CRELD1-deficient mice maintain normal T cell numbers

  • Mice older than 11 months show significantly decreased T cell numbers compared to age-matched controls

  • Markers of immunosenescence appear prematurely in knockout mice

  • CRELD1-deficient T cells show altered differentiation potential and increased susceptibility to apoptosis

Transcriptomic analyses revealed that CRELD1-deficient T cells exhibit dysregulation of genes associated with T cell homeostasis, activation, and apoptosis, along with significant downregulation of Wnt signaling pathways . This molecular signature closely mirrors expression patterns observed in human subjects with low CRELD1 expression, confirming the translational relevance of these findings.

These observations collectively suggest that CRELD1 maintains naïve T cell pools during aging by regulating cell survival pathways, with loss of CRELD1 function accelerating immunological aging.

What methodological approaches can be used to study CRELD1's effects on T cell signaling pathways?

Researchers investigating CRELD1's impact on T cell signaling can employ multiple complementary approaches:

  • Transcriptomic profiling: RNA sequencing of CRELD1-deficient versus control T cells helps identify dysregulated signaling pathways. This approach has revealed alterations in NFAT and Wnt signaling in CRELD1-deficient T cells .

  • Phosphoproteomic analysis: Mass spectrometry-based phosphoproteomics can identify changes in phosphorylation status of key signaling molecules in the absence of CRELD1, providing insight into affected signal transduction cascades.

  • Reporter assays: Luciferase-based reporter constructs for specific signaling pathways (e.g., NFAT, Wnt) can quantitatively measure pathway activity in CRELD1-manipulated cells.

  • Flow cytometry-based approaches: Intracellular staining for phosphorylated signaling molecules or transcription factors can assess pathway activation at the single-cell level.

  • T cell functional assays: Assessing proliferation, cytokine production, and differentiation capacity of CRELD1-deficient T cells under various stimulation conditions provides functional readouts of altered signaling.

When implementing these approaches, researchers should consider both acute CRELD1 depletion (using siRNA or CRISPR-Cas9) and chronic deficiency models (conditional knockout mice) to distinguish between immediate signaling defects and compensatory adaptations.

What are the mechanisms by which CRELD1 mutations contribute to atrioventricular septal defects (AVSD)?

CRELD1 mutations are associated with nonsyndromic atrioventricular septal defects (AVSD), which account for over 7% of all congenital heart defects in humans . The mechanisms underlying this association involve multiple pathways:

  • Endocardial cushion development: Complete loss of CRELD1 in mouse models causes embryonic lethality by day 11.5-12.5 with abnormal endocardial cushion formation, the precursor structures that form the atrioventricular septum .

  • Increased apoptosis: CRELD1-deficient embryos show elevated apoptosis specifically in developing cardiac tissues and branchial arches, disrupting normal morphogenesis .

  • Vascular insufficiency: CRELD1 knockout mice exhibit poor embryonic and yolk sac vascularization, potentially contributing to cardiac developmental defects through impaired nutrient delivery .

  • Placental abnormalities: CRELD1 deficiency leads to abnormal placental development, suggesting both direct cardiac effects and indirect effects through compromised placental function .

  • Genetic interaction with VEGF: Perhaps most significantly, CRELD1 mutations display a functional interaction with VEGF (Vascular Endothelial Growth Factor) signaling. The VEGF-634C polymorphism, which causes VEGF overexpression, is strongly associated with AVSD and renders CRELD1 mutations fully penetrant for AVSD when both genetic variants are present .

This CRELD1-VEGF interaction has been experimentally validated using endocardial cushion explant assays, where CRELD1-deficient cushions develop abnormally when exposed to elevated VEGF levels, establishing the first defined AVSD-risk genetic profile .

How can researchers effectively model CRELD1-associated cardiac defects in laboratory settings?

Researchers can employ several complementary approaches to model and investigate CRELD1-associated cardiac defects:

  • Mouse genetic models:

    • Constitutive Creld1 knockout mice (Creld1−/−) demonstrate embryonic lethality with cardiac defects by E11.5-12.5

    • Heterozygous mice (Creld1+/−) are viable but may show subtle developmental abnormalities

    • Conditional tissue-specific knockouts using Cre-lox technology can target CRELD1 deletion to specific cardiac cell populations

  • Ex vivo explant cultures:

    • Atrioventricular canal explant assays allow direct manipulation of endocardial cushion development

    • These can be combined with recombinant protein treatments (e.g., VEGF) to study genetic interactions

    • Time-lapse imaging enables visualization of dynamic developmental processes

  • Human induced pluripotent stem cells (iPSCs):

    • Patient-derived iPSCs carrying CRELD1 mutations can be differentiated into cardiac lineages

    • CRISPR/Cas9 gene editing can introduce or correct specific CRELD1 variants

    • 3D cardiac organoids provide a more physiologically relevant context for studying developmental processes

  • Zebrafish models:

    • CRISPR/Cas9 or morpholino-based knockdown of creld1 in zebrafish embryos

    • Transparent embryos allow real-time visualization of cardiac development

    • High-throughput screening of potential therapeutic compounds

When designing these models, researchers should consider the multifactorial nature of AVSD etiology, potentially incorporating second genetic hits (such as VEGF polymorphisms) to recapitulate the full disease spectrum observed in humans.

What is the emerging evidence for CRELD1's role in epilepsy and neurodevelopmental disorders?

Recent clinical findings have identified a newly characterized CRELD1-related disorder with prominent neurological manifestations. This autosomal recessive condition, caused by sequence changes in different regions of the CRELD1 gene than those associated with cardiac defects, presents with:

  • Multiple, frequent, treatment-resistant epileptic seizures

  • Severe developmental and cognitive delays ranging from mild movement disorders to profound impairments

  • Severe bilateral neural hearing loss

  • Immature eye development

  • Additional systemic manifestations including adrenal insufficiency, acute respiratory distress, and submucosal cleft palate

The neurological aspects of this syndrome suggest previously unrecognized roles for CRELD1 in central nervous system development and function. Notably, affected individuals can experience upwards of 80-100 seizures daily, indicating a significant impact on neuronal excitability .

This emerging connection between CRELD1 and neurological disorders represents an important new direction for research that may reveal novel pathophysiological mechanisms underlying certain forms of epilepsy and neurodevelopmental conditions.

What experimental approaches would be most effective for investigating CRELD1's function in neurons?

Investigating CRELD1's neuronal functions requires specialized techniques that address both developmental and functional aspects:

  • Primary neuronal cultures:

    • CRELD1 knockout or knockdown in primary neurons using CRISPR or shRNA

    • Live imaging of calcium dynamics and mitochondrial function

    • Electrophysiological recordings to assess neuronal excitability and synaptic transmission

    • Immunocytochemistry to examine receptor trafficking and localization

  • Brain organoids:

    • Generation of cerebral organoids from control and CRELD1-deficient iPSCs

    • Assessment of neuronal differentiation, migration, and circuit formation

    • Multi-electrode array recordings to evaluate network activity and seizure-like events

  • In vivo neurodevelopmental models:

    • Conditional CRELD1 knockout in specific neuronal populations using Cre-lox systems

    • EEG recordings to monitor seizure activity

    • Behavioral testing to assess cognitive and motor functions

    • Optogenetic or chemogenetic manipulation of CRELD1-deficient circuits

  • Receptor trafficking studies:

    • Pulse-chase labeling of newly synthesized receptors in CRELD1-deficient neurons

    • Surface biotinylation assays to quantify receptor membrane expression

    • FRAP (Fluorescence Recovery After Photobleaching) to assess receptor mobility

    • Super-resolution microscopy to visualize receptor clustering

  • Multiomics approaches:

    • Proteomics to identify CRELD1 interacting partners in neuronal contexts

    • Transcriptomics to define CRELD1-dependent gene expression programs in neurons

    • Metabolomics to assess changes in neuronal energy metabolism

These approaches should be integrated with careful phenotypic characterization of patients with CRELD1-related epilepsy to establish genotype-phenotype correlations and identify the most relevant pathways for therapeutic intervention.

How can systems biology approaches advance our understanding of CRELD1's multiple cellular roles?

CRELD1 functions across multiple cellular processes, making it an ideal candidate for systems biology investigation. Integrative approaches can reveal how CRELD1 coordinates diverse functions:

  • Interactome mapping: Comprehensive identification of CRELD1's protein-protein interactions across different cellular compartments and tissues using proximity labeling approaches (BioID, APEX) or affinity purification mass spectrometry. This can reveal tissue-specific interaction networks that explain CRELD1's diverse functions .

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from CRELD1-deficient systems can identify convergent pathways affected across different tissues. This approach has already yielded insights from population variance studies, where CRELD1 expression levels were correlated with immunological parameters and transcriptomic signatures .

  • Network analysis: Computational integration of CRELD1-associated datasets with existing interaction networks can predict functional relationships and identify hub proteins that mediate CRELD1's effects on different cellular processes. This may explain how CRELD1 influences both NFAT and Wnt signaling in T cells while also affecting mitochondrial dynamics .

  • Temporal dynamics modeling: Time-resolved data collection following CRELD1 perturbation can distinguish primary effects from secondary consequences, helping to establish causal relationships between CRELD1 activity and downstream cellular responses.

Implementation of these approaches requires collaboration between experimental biologists and computational scientists to generate and integrate diverse datasets into coherent models of CRELD1 function.

What are the challenges and best practices in producing recombinant CRELD1 for structural and functional studies?

Producing functional recombinant CRELD1 presents several challenges due to its complex structure and post-translational modifications:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) best recapitulate native post-translational modifications

    • Insect cell systems (Sf9, Hi5) offer a compromise between yield and proper folding

    • Bacterial systems typically yield improperly folded protein due to inability to form correct disulfide bonds

  • Construct design considerations:

    • Inclusion of appropriate signal peptides for ER targeting

    • Careful selection of purification tags that don't interfere with protein folding

    • Generation of truncation constructs to identify soluble domains for structural studies

    • Codon optimization for the chosen expression system

  • Purification strategies:

    • Two-step purification typically required for high purity

    • Detergent selection critical for membrane-associated CRELD1 isoforms

    • Buffer optimization to maintain stability during concentration

  • Functional validation:

    • Verification of disulfide isomerase activity using model substrates

    • Binding assays with known interacting partners (e.g., AChR subunits)

    • Thermal shift assays to confirm proper folding

  • Storage considerations:

    • Flash freezing in small aliquots to avoid freeze-thaw cycles

    • Addition of stabilizing agents specific to PDI family proteins

    • Stability testing at different temperatures and buffer conditions

Researchers have found that expression of the soluble luminal domain of CRELD1 (without transmembrane regions) often yields more stable protein for structural studies, while full-length constructs are necessary for certain functional assays. The inclusion of PDI family-specific additives such as reduced/oxidized glutathione in purification buffers can help maintain the catalytic activity of recombinant CRELD1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.