Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1)

Shipped with Ice Packs
In Stock

Description

Introduction to CYSLTR1

Cysteinyl Leukotriene Receptor 1 (CYSLTR1) functions as a receptor for cysteinyl leukotrienes (CysLTs), which are arachidonic acid derivatives including leukotriene C4 (LTC4), leukotriene D4 (LTD4), and leukotriene E4 (LTE4). The human CYSLTR1 gene is located on the X chromosome at position Xq13-Xq21 and contains three exons, with the entire open reading frame situated in exon 3 . This gene encodes a protein composed of 337 amino acids, and its promoter region is positioned between 665 and 30 base pairs upstream of the transcription start site . CYSLTR1 belongs to the G protein-coupled receptor 1 family and plays a fundamental role in mediating bronchoconstriction through activation of a phosphatidylinositol-calcium second messenger system .

The expression pattern of CYSLTR1 is remarkably diverse, occurring in numerous tissues and cell types throughout the body. CYSLTR1 mRNA is expressed in lung smooth muscle, lung macrophages, monocytes, eosinophils, basophils, neutrophils, platelets, T cells, B lymphocytes, pluripotent hematopoietic stem cells (CD34+), mast cells, pancreas, small intestine, prostate, interstitial cells of the nasal mucosa, airway smooth muscle cells, bronchial fibroblasts, and vascular endothelial cells . This widespread expression pattern underlies its significance in multiple physiological and pathological processes beyond respiratory function.

CYSLTR1 is also known by several alternative names in scientific literature, including CLTR1, CysLT1, CysLT1R, and HMTMF81 . The gene has been assigned several external identifiers in biological databases, including HGNC: 17451, NCBI Gene: 10800, and UniProtKB/Swiss-Prot: Q9Y271 .

Functional Roles of CYSLTR1

CYSLTR1 functions as a G protein-coupled receptor that, when bound to its cysteinyl leukotriene ligands, activates specific G protein subunits, particularly the Gq alpha subunit and/or Ga subunit, with the specific subunit activation pattern varying depending on cell type . Through these G proteins and their subunits, ligand-bound CYSLTR1 initiates a cascade of signaling pathways that regulate various cell functions . The receptor demonstrates a distinct order of potency for cysteinyl leukotrienes: LTD4 > LTC4 > LTE4, with LTE4 likely possessing insufficient potency to elicit significant CYSLTR1-mediated activity under physiological conditions .

When activated by its primary ligands LTC4 and/or LTD4, CYSLTR1 induces several physiological responses in both animal models and humans. These responses include airway bronchoconstriction and hyper-responsiveness to other bronchoconstriction agents such as histamine . Additionally, CYSLTR1 activation increases vascular permeability, leading to edema, and promotes the recruitment and influx of inflammatory cells, particularly eosinophils and neutrophils, to affected tissues . The receptor also stimulates smooth muscle proliferation, collagen deposition, and fibrosis in various tissue sites .

In the respiratory system specifically, CYSLTR1 activation triggers mucin secretion by goblet cells, induces goblet cell metaplasia, and promotes epithelial cell hypertrophy in the airway membranes . This collection of effects contributes significantly to the pathophysiology of asthma and other inflammatory respiratory conditions, explaining why CYSLTR1 has become an important therapeutic target in these diseases.

Beyond its established role in respiratory and inflammatory responses, CYSLTR1 has been implicated in neurological processes. Preclinical studies using animal models and human tissue suggest that CYSLTR1 antagonists may have protective and reparative effects in various neurological conditions, including brain injury (trauma-, ischemia-, and cold-induced), multiple sclerosis, auto-immune encephalomyelitis, Alzheimer's disease, and Parkinson's disease . CYSLTR1 activation is associated with compromising blood-brain barrier integrity, thereby increasing the permeability of brain capillaries to soluble elements in the blood and facilitating leukocyte movement from the bloodstream into brain tissues . These effects may contribute to the development and increased frequency of epileptic seizures and facilitate the entry of leukocyte-borne viruses, such as HIV-1, into brain tissue .

Pathophysiological Implications

CYSLTR1 plays a pivotal role in several pathophysiological conditions, most notably asthma and other inflammatory disorders. The receptor mediates bronchoconstriction in all individuals, though its effects are particularly pronounced in those with asthma . When stimulated by LTD4, CYSLTR1 activation results in contraction and proliferation of bronchial smooth muscle cells, edema formation, eosinophil migration, and damage to the mucus layer in the lung . These effects collectively contribute to the characteristic symptoms and underlying pathophysiology of asthma.

Diseases specifically associated with CYSLTR1 include exercise-induced bronchoconstriction and asthma . Upregulation of the CYSLTR1 gene is strongly associated with asthmatic conditions, and dysregulation of this receptor may also be implicated in cancer development . Given its central role in mediating inflammatory responses, CYSLTR1 has emerged as an important therapeutic target. Selective antagonists of CYSLTR1, such as montelukast, are used clinically in the treatment of asthma with considerable efficacy .

Recent research has revealed unexpected roles for CYSLTR1 in fundamental cellular processes such as autophagy and endosomal-lysosomal function, suggesting potential implications in age-related diseases beyond traditional inflammatory conditions . The involvement of CYSLTR1 in autophagy regulation is particularly significant given that impairment of autophagy correlates highly with aging and age-related diseases . This discovery opens new avenues for investigating CYSLTR1 as a potential therapeutic target in conditions associated with dysfunctional cellular homeostasis.

Table 2: Pathophysiological Roles of CYSLTR1

ConditionRole of CYSLTR1Physiological EffectsSource
AsthmaMediates bronchoconstrictionSmooth muscle contraction, airway narrowing
InflammationPromotes inflammatory cell recruitmentEosinophil migration, edema, tissue damage
Neurological disordersAffects blood-brain barrier integrityIncreased permeability, leukocyte infiltration
Cellular homeostasisRegulates autophagyModulation of lysosomal function and endocytosis
Exercise-induced bronchoconstrictionMediates airway hyperresponsivenessBronchial smooth muscle contraction

Recombinant CYSLTR1 in Research Applications

Recombinant Human CYSLTR1 proteins and membrane preparations have become essential tools for research into this receptor's structure, function, and potential therapeutic applications. Commercial sources offer recombinant CYSLTR1 with high purity (≥85%), suitable for various research applications, including SDS-PAGE analysis and functional studies . These recombinant proteins typically contain the full-length sequence (amino acids 1-337) and are produced in cell-free expression systems to ensure consistency and scalability .

Membrane preparations containing recombinant CYSLTR1 are particularly valuable for ligand binding studies and high-throughput screening of potential antagonists or agonists . These preparations are derived from stable recombinant cell lines engineered to express high levels of functional CYSLTR1 on the cell surface . For example, the ChemiSCREEN Membrane Preparation of Recombinant Human CYSLTR1 exhibits a binding affinity (Kd) of 0.97 nM for [³H]-Leukotriene D4 and is suitable for both radioligand binding assays and GTPγS binding studies .

The availability of these research tools has facilitated significant advances in our understanding of CYSLTR1 biology and its potential as a therapeutic target. Recombinant CYSLTR1 proteins and membrane preparations are used in a wide range of applications, including structure-function analyses, ligand binding studies, high-throughput compound screening, and the development and validation of assays for evaluating potential therapeutic compounds targeting this receptor.

Recent research utilizing recombinant CYSLTR1 has revealed novel roles for this receptor in cellular processes beyond inflammation, particularly in autophagy regulation and endosomal-lysosomal function . These discoveries highlight the value of recombinant CYSLTR1 as a research tool for exploring the receptor's diverse biological functions and potential therapeutic applications.

Recent Research Findings

Recent studies have uncovered novel roles for CYSLTR1 beyond its well-established functions in inflammation and bronchoconstriction. Particularly significant are findings regarding CYSLTR1's involvement in autophagy regulation and the endosomal-lysosomal system, which have expanded our understanding of this receptor's biological significance.

A study published in 2021 investigated the chronobiological activity of CYSLTR1 during basal and induced autophagy in the ARPE-19 retinal pigment epithelial cell line . Autophagy represents a crucial cellular mechanism for maintaining homeostasis, and its impairment correlates strongly with aging and age-related diseases . The researchers demonstrated that CYSLTR1 functions as a potential regulator of both basal and adaptive autophagy . Given that basal autophagy is a dynamic process, the study aimed to define CYSLTR1's role in autophagy regulation within a chronobiologic context . The effects of CYSLTR1 inhibition on basal autophagic activity were analyzed at periods of both inactive/low and high lysosomal degradation activity using the CYSLTR1 antagonists zafirlukast (ZTK) and montelukast (MTK) at a dosage of 100 nM for 3 hours .

Building on these findings, a subsequent study published in 2023 provided deeper insights into how CYSLTR1 regulates the autophagic process via the endosomal-lysosomal pathway . This research identified CYSLTR1 as a potent regulator of the endosomal-lysosomal system in ARPE-19 cells . The study demonstrated that inhibition of CYSLTR1 by zafirlukast significantly depleted the cellular lysosomal pool . Furthermore, CYSLTR1 antagonization reduced endocytic capacity, impaired internalization of epidermal growth factor, and decreased expression levels of the transferrin receptor, CD71 .

A particularly intriguing finding from this research was that serum starvation abolished the effect of zafirlukast on autophagic flux, suggesting that endocytic regulation of serum components by CYSLTR1 represents an important autophagy-modulating mechanism . This observation highlights the interconnection between CYSLTR1 signaling, endocytosis, and autophagy regulation, revealing a complex role for this receptor in cellular homeostasis.

Table 3: Recent Research Findings on CYSLTR1 Function

Study FocusKey FindingsExperimental SystemImplicationsSource
Chronobiological activity in autophagyCYSLTR1 regulates basal and adaptive autophagyARPE-19 cellsRole in cellular homeostasis
Endosomal-lysosomal regulationCYSLTR1 inhibition depletes lysosomal poolARPE-19 cellsControl of lysosomal function
Endocytic capacityCYSLTR1 antagonism reduces EGF internalizationARPE-19 cellsRegulation of endocytosis
Transferrin receptor expressionCYSLTR1 inhibition decreases CD71 levelsARPE-19 cellsInfluence on receptor trafficking
Autophagy under starvationSerum starvation abolishes zafirlukast effects on autophagySerum-starved ARPE-19 cellsNutrient-dependent regulation

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5% to 50% glycerol. For lyophilized powder, the buffer used prior to lyophilization is a Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized Powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
3-7 business days
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We advise centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
CYSLTR1; CYSLT1; Cysteinyl leukotriene receptor 1; CysLTR1; Cysteinyl leukotriene D4 receptor; LTD4 receptor; G-protein coupled receptor HG55; HMTMF81
Datasheet & Coa
Please contact us to get it.
Expression Region
1-337aa
Mol. Weight
44.6 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Cysteinyl leukotriene receptor 1 (CysLTR1) is a receptor responsible for mediating bronchoconstriction in individuals with and without asthma. Activation by leukotriene D4 (LTD4) triggers various responses in the lung, including smooth muscle contraction and proliferation, edema formation, eosinophil migration, and damage to the mucus layer. These effects are mediated through a G-protein that activates a phosphatidylinositol-calcium second messenger system. The receptor demonstrates a strong preference for LTD4, followed by LTE4 and LTC4, while exhibiting a much lower affinity for LTB4.
Gene References Into Functions
  1. CysLTR1 and CysLTR2 expression levels are elevated in the lymphocytes of hyperplasic tonsils in nonallergic children. PMID: 27221082
  2. Staphylococcal enterotoxin (SE) sensitization might contribute to the development of TH2 inflammation in nonatopic asthma and late-onset asthma. Additionally, it might be associated with a decline in pulmonary function in nonatopic asthma. In women with asthma, a CysLTR1 promoter polymorphism could be linked to SEB sensitization. PMID: 28034578
  3. Montelukast, a CysLTR1 antagonist, has been shown to suppress TGF-beta1-induced expression of MMP-1 and MMP-3, fibronectin generation, type I collagen production, and focal adhesion kinase (FAK) and paxillin phosphorylation in human tenocytes. These findings suggest potential therapeutic benefits of montelukast in inhibiting scar formation after surgery. PMID: 28088523
  4. CysLTRs -1 and -2 appear to play a role in lymphocyte maturation within tonsils, independent of allergic reactions. PMID: 27115897
  5. Studies indicate that individuals using cysteinyl leukotriene receptor antagonists (LTRAs) had a significantly lower cancer incidence rate compared to those not using LTRAs. PMID: 27052782
  6. Allergen exposure can enhance T cell expression of CysLT1 in allergen-sensitized individuals. This, in turn, may lead to increased CD4+ T cell responsiveness to cysLTs, T cell activation, and Th2 polarization. PMID: 25918735
  7. High expression of CysLTR-1 and CysLTR-2 has been observed in adenoid tissues from children with adenoid hypertrophy, suggesting a potential role for leukotrienes in the pathogenesis of this condition. PMID: 25760841
  8. The 5-LOX/LTC4/CysLT1 signaling pathway regulates EGF-induced cell migration by increasing Tiam1 expression. PMID: 24350867
  9. Cysteinyl leukotrienes signaling downstream of CysLT1R in mast cells is differentially regulated by two distinct PKCalpha and PKC epsilon. PMID: 23977066
  10. CysLT(1) receptors in endothelial cells translocate to the nucleus in a ligand-independent manner following ischemic insult in vitro, suggesting a role in ischemic injury. PMID: 23085741
  11. A significant correlation has been observed between the expression of CysLT1 receptor and GR-beta in nasal polyps (R = .525, P = .04), while no significant relationship was found between CysLT1 receptor and GR-alpha expression. PMID: 23124618
  12. Genetic variants in CysLTR1 might contribute to the development of NSAID-induced acute urticaria. PMID: 23181793
  13. Nuclear CysLT(1) receptor signaling in vascular smooth muscle cells may contribute to gene expression patterns associated with atherosclerosis. PMID: 22527886
  14. CysLT1 receptor-positive inflammatory cells are found in the bronchial mucosa of individuals with chronic obstructive pulmonary disease (COPD), particularly in those experiencing severe exacerbations. PMID: 22871757
  15. Increased expression of CysLTR1 has been reported in tonsillar tissues of Chinese children with sleep-disordered breathing. PMID: 22634478
  16. Data suggest that CysLT1 induces chemokine-like effects, supporting the accumulation and survival of chronic lymphocytic leukemia (CLL) cells in the bone marrow, potentially making it a therapeutic target. PMID: 21936770
  17. Cysteinyl-leukotriene receptors exhibit different expression levels in fibroblasts from peripheral versus central airways in asthmatics and healthy controls. PMID: 21596548
  18. Upon ligand activation, CysLT(1)R undergoes tyrosine phosphorylation, dissociates from heterodimers with CysLT(2)R, and subsequently internalizes from the plasma membrane to the nuclear membrane in a clathrin-, arrestin-3-, and Rab-5-dependent manner. PMID: 21203429
  19. CysLT1-R expression is influenced by allergen provocation in asthma and allergic rhinitis. PMID: 20462748
  20. Studies demonstrate functional expression of CysLT1 and 2 receptors on human platelets and show that CysLTs induce the release of significant amounts of RANTES, suggesting a novel role for human platelets in CysLT-mediated allergic inflammation. PMID: 20433311
  21. Genetic variants in the CYSLTR1 promoter might be associated with gender-specific expression of CysLT1 alternative transcripts in patients with asthma. PMID: 20003473
  22. The interaction of CysLTs and CysLT(1) on eosinophils might play a significant role in the pathophysiology of asthma. PMID: 12373000
  23. CysLT1R expression, upregulated by IL-13 and leukotriene C4, may contribute to eotaxin production by lung fibroblasts. PMID: 12682264
  24. CysLT1 receptor upregulation by TGF-beta and IL-13 is associated with bronchial smooth muscle cell proliferation in response to LTD4. PMID: 12743568
  25. Arachidonic acid inhibits cysteinyl-leukotriene receptor activation in human pulmonary vessels. PMID: 12751740
  26. CysLTR1 is upregulated in colon cancer, potentially affecting survival. PMID: 12751768
  27. Research highlights the importance of increased CysLT signaling in airway smooth muscle function. PMID: 15064240
  28. CysLT1R stands out as the first G protein-coupled receptor identified to date where protein kinase C is the primary regulator of both rapid agonist-dependent internalization. PMID: 15590629
  29. CysLT 1 expression is predominantly found on inflammatory leukocytes in aspirin-sensitive rhinosinusitis. The effects of cysteinyl leukotrienes on glands and epithelium might be mediated primarily through cysLT 2, potentially carrying important therapeutic implications. PMID: 15696087
  30. Increased nuclear localization of the CysLT(1) receptor has been observed in colorectal adenocarcinomas. PMID: 15705869
  31. Upregulation of the cysteinyl leukotriene-1 receptor is associated with asthma. PMID: 16123393
  32. Leukotriene D4, acting through the CysLT1 receptor, can transcriptionally activate IL-8 production, involving the transcription factors p50, p65, Fos, and Jun. PMID: 16809637
  33. The 927T>C CYSLTR1 SNP was analyzed by direct sequencing after PCR amplification in children with asthma and atopic dermatitis. PMID: 16846449
  34. The C allele of 927T>C CYSLTRI was found to be more prevalent among male patients with asthma than controls. PMID: 17153879
  35. Desensitization of the CysLT1R is the primary mechanism by which PKC regulates the functional consequences of its desensitization in tracheal smooth muscle. PMID: 17392478
  36. Research focuses on the analysis of polymorphism and differential regulation of CYSLTR1 transcription in human airway smooth muscle and monocytes. PMID: 17406065
  37. Overexpression of the cysteinyl LT1 receptor has been linked to prostate cancer. PMID: 17549353
  38. A CysLT1 G300S variant has been identified, exhibiting a significantly higher frequency in atopic and asthmatic individuals from the Tristan da Cunha population. PMID: 17558309
  39. CysLTR1 polymorphism may contribute to the development of the aspirin-intolerant asthma phenotype and can be used as a genetic marker for differentiating two major aspirin hypersensitivity phenotypes. PMID: 17641958
  40. CysLT2R signaling leads to terminal differentiation of colon carcinoma cells and growth inhibition, and its expression is relatively high in less malignant forms of colon cancer. PMID: 17909024
  41. CysLTR1 promoter polymorphism serves as a useful genetic marker for predicting the need for leukotriene receptor antagonist treatment in aspirin-intolerant asthma patients. PMID: 17924829
  42. CysLT1R and CysLT2R expression in monocytes can be regulated by CysLT itself and T(H)2 cytokines at the transcriptional level. PMID: 17941281
  43. Research indicates that CysLTs, acting through CysLTR(1), can significantly influence the activation and migration of human monocytes. PMID: 18028998
  44. STAT-1 is involved in the signal transduction mechanism associated with cysteinyl leukotriene receptor 1 activation, supporting the hypothesis that it might represent a key transduction pathway leading to enhanced eosinophil adhesiveness. PMID: 18305014
  45. CysLT1 is implicated in remodeling processes through modulation of furin transcription. PMID: 18323532
  46. Studies explore the long-term effect of Helicobacter pylori eradication on COX-1/2, 5-LOX, and leukotriene receptors in patients with a risk gastritis phenotype, potentially linking these factors to gastric carcinogenesis. PMID: 18571838
  47. Cysteinyl leucotrienes induce contraction in both human and guinea-pig esophagus, mediated by the cysteinyl leucotriene receptor type 1. PMID: 18651869
  48. SNP rs320995 in the cysteinyl leukotriene receptor 1 gene has been associated with the risk of asthma. PMID: 18829683
  49. Combined analysis of polymorphisms in genes of the leukotriene pathway could explain discrepancies observed in individual analyses of the -444A < C LTC4S polymorphism. PMID: 19080797
  50. LTD(4), the most potent CysLT(1) ligand, rapidly and significantly upregulated alpha(4)beta(1) and alpha(5)beta(1) integrin-dependent adhesion of both primitive and committed hematopoietic progenitor cells. PMID: 19454674

Show More

Hide All

Database Links

HGNC: 17451

OMIM: 300201

KEGG: hsa:10800

STRING: 9606.ENSP00000362401

UniGene: Hs.733809

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon and heart.

Q&A

How does CYSLTR1 recognize and distinguish between different ligands?

CYSLTR1 exhibits selective binding to cysteinyl leukotrienes with a potency order of LTD4 > LTC4 > LTE4. Binding studies indicate that LTE4 likely lacks sufficient potency to significantly activate CYSLTR1 under physiological conditions .

Structural studies using crystal structures of CYSLTR1 bound to antagonists have revealed unique ligand-binding modes, including lateral ligand access to the orthosteric pocket between transmembrane helices TM4 and TM5. The receptor contains a distinct four-residue-coordinated sodium site and displays an atypical pattern of microswitches that contribute to its ligand recognition properties .

Recent crystallographic data provide molecular insights into how CYSLTR1 and CYSLTR2 achieve ligand selectivity. Computer modeling and mutagenesis studies have identified specific residues in the binding pocket that determine differential affinity for various ligands, which is crucial for developing receptor-selective antagonists .

What are the main physiological effects mediated by CYSLTR1 activation?

CYSLTR1 activation by its primary ligands (LTC4 and LTD4) triggers multiple physiological responses in both animal models and humans:

  • Airway effects: Bronchoconstriction and increased hyper-responsiveness to bronchoconstrictive agents like histamine

  • Vascular effects: Increased vascular permeability and edema

  • Inflammatory cell recruitment: Influx of eosinophils and neutrophils to tissues

  • Tissue remodeling: Smooth muscle proliferation, collagen deposition, and fibrosis

  • Mucus production: Increased mucin secretion by goblet cells, goblet cell metaplasia, and epithelial cell hypertrophy

These effects collectively contribute to various inflammatory and allergic responses, particularly in asthma and other respiratory disorders, where CYSLTR1 antagonists have proven therapeutic value .

What is the tissue distribution of CYSLTR1 expression?

CYSLTR1 mRNA is widely expressed across multiple tissues and cell types, with significant expression in:

Immune cells:

  • Monocytes

  • Macrophages (including lung macrophages)

  • Eosinophils

  • Basophils

  • Neutrophils

  • T cells and B lymphocytes

  • Mast cells

  • Pluripotent hematopoietic stem cells (CD34+)

  • Platelets

Structural cells:

  • Airway smooth muscle cells

  • Bronchial fibroblasts

  • Vascular endothelial cells

  • Interstitial cells of the nasal mucosa

Organs and tissues:

  • Lung (particularly smooth muscle)

  • Pancreas

  • Small intestine

  • Prostate

This broad expression pattern explains the diverse physiological and pathological roles of CYSLTR1 in inflammatory processes throughout the body.

How is CYSLTR1 internalization regulated after ligand binding?

CYSLTR1 undergoes rapid and profound internalization upon stimulation with LTD4. Unlike many other GPCRs, CYSLTR1 internalization is primarily regulated by protein kinase C (PKC) rather than arrestins. This was demonstrated in studies where:

  • A C-terminal truncation mutant exhibited impaired internalization while maintaining robust signaling, identifying a critical region within amino acids 310-321 for internalization

  • Pharmacological inhibition of PKC profoundly inhibited CYSLTR1 internalization while significantly increasing both phosphoinositide production and calcium mobilization

  • Mutation of putative PKC phosphorylation sites within the CYSLTR1 C-tail (CysLT1RS(313-316)A) reduced receptor internalization and enhanced signaling responses

This unique regulatory mechanism distinguishes CYSLTR1 from most other GPCRs, making it the first identified receptor where PKC serves as the principal regulator of both rapid agonist-dependent internalization and rapid agonist-dependent desensitization .

How does CYSLTR1 expression change in disease states?

CYSLTR1 expression is dynamically regulated in various disease conditions. In systemic lupus erythematosus (SLE), CYSLTR1 expression is significantly elevated in patients compared to healthy controls and correlates with disease activity. This elevated expression appears to be driven by DNA demethylation, suggesting epigenetic regulation of CYSLTR1 in autoimmune conditions .

In cancer, particularly breast cancer, altered CYSLTR1 expression correlates with clinical outcomes. Low CYSLTR1 expression is associated with worse survival in breast cancer patients generally, with particularly significant effects in triple-negative breast cancer (TNBC) . These findings suggest that CYSLTR1 may serve as a prognostic marker in certain cancer types.

What are the primary signaling pathways activated by CYSLTR1?

CYSLTR1 activates multiple signaling pathways through its coupling to G proteins:

  • G protein coupling: CYSLTR1 primarily functions as a G protein-coupled receptor that links to and activates:

    • Gq alpha subunit

    • Ga subunit (depending on the cell type)

  • Downstream effectors:

    • Phosphatidylinositol-calcium second messenger system

    • PI3K/AKT/mTOR pathway activation (particularly relevant in B cells)

  • Cellular responses:

    • Calcium mobilization

    • Activation of protein kinase C

    • Contraction and proliferation of smooth muscle cells

    • Eosinophil migration

    • Damage to the mucus layer in the lung

In B cells, CYSLTR1 signaling influences the BCL6-BLIMP1-XBP1 axis, which is crucial for B cell differentiation and antibody production. Inhibition of CYSLTR1 downregulates these transcription factors by suppressing the PI3K/AKT/mTOR pathway .

How does protein kinase C (PKC) specifically regulate CYSLTR1 function?

PKC plays a central and unique role in regulating CYSLTR1 function through several mechanisms:

  • Receptor internalization: PKC is the primary regulator of agonist-induced internalization of CYSLTR1. Pharmacological inhibition of PKC profoundly inhibits CYSLTR1 internalization.

  • Signal termination: PKC mediates rapid agonist-dependent desensitization of CYSLTR1, controlling the duration and intensity of receptor signaling.

  • Phosphorylation sites: The region between amino acids 310-321 in the C-terminal tail contains putative PKC phosphorylation sites. Mutation of these sites (CysLT1RS(313-316)A) reduces receptor internalization and enhances signaling.

  • Signaling intensity: PKC inhibition increases both phosphoinositide production and calcium mobilization stimulated by LTD4, suggesting PKC normally attenuates these signaling pathways.

This PKC-dependent regulation distinguishes CYSLTR1 from other GPCRs, where arrestins typically play the predominant role in receptor internalization and desensitization .

How does CYSLTR1 contribute to inflammatory pathways in immune cells?

In immune cells, CYSLTR1 signaling activates multiple inflammatory pathways:

  • In B cells: CYSLTR1 activation promotes B cell differentiation into antibody-secreting cells through regulation of the BCL6-BLIMP1-XBP1 transcriptional axis. In SLE models, CYSLTR1 knockout mice exhibit reduced plasma cell frequencies and decreased lupus-like symptoms .

  • In macrophages: CYSLTR1 signaling induces the release of pro-inflammatory mediators and chemokines, contributing to inflammatory cell recruitment.

  • In eosinophils and neutrophils: CYSLTR1 activation promotes migration and activation of these cells, contributing to tissue inflammation.

  • In T cells: CYSLTR1 modulates T cell responses, potentially contributing to inflammatory and allergic reactions.

Experiments using CYSLTR1 inhibition with antagonists like montelukast show reduction in antibody-secreting cells and plasmablasts in lupus models, demonstrating the receptor's importance in B cell-mediated immune responses .

What is the role of CYSLTR1 in systemic lupus erythematosus (SLE)?

CYSLTR1 plays a significant role in SLE pathogenesis through several mechanisms:

  • Expression correlation: CYSLTR1 expression is elevated in SLE patients and correlates with disease activity, likely driven by DNA demethylation.

  • B cell function: CYSLTR1 regulates B cell differentiation and antibody production through the BCL6-BLIMP1-XBP1 transcriptional axis.

  • Experimental evidence: In a pristane-induced lupus model, CYSLTR1-knockout mice exhibited:

    • Reduced lupus-like symptoms

    • Decreased plasma cell frequencies

    • Attenuated immune responses

  • Mechanism of action: CYSLTR1 inhibition downregulates BCL6, BLIMP1, and XBP1 in B cells by suppressing the PI3K/AKT/mTOR pathway, leading to:

    • Reduced antibody-secreting cells (ASCs)

    • Decreased immunoglobulin production

  • Therapeutic potential: Montelukast (a CYSLTR1 antagonist) ameliorated SLE manifestations in two murine lupus models by reducing antibody-secreting cells and plasmablasts .

These findings suggest CYSLTR1 antagonism could represent a novel therapeutic approach for SLE treatment.

How does CYSLTR1 expression influence cancer progression?

CYSLTR1 expression appears to have important implications in cancer, particularly in breast cancer:

  • Prognostic value: Low CYSLTR1 expression is associated with worse survival in breast cancer patients generally, with particularly pronounced effects in triple-negative breast cancer (TNBC) .

  • Expression analysis: Studies using platforms like UALCAN, GENT2, and TCGA databases have established correlations between CYSLTR1 expression levels and clinical outcomes in breast cancer.

  • Molecular networks: Co-expression analysis conducted using RNA-seq data of TNBC from the bc-GenExMiner database identified gene networks associated with CYSLTR1 function that may influence cancer progression .

  • Other cancers: CYSLTR1 has been implicated in several other cancer types, including colorectal cancer where recent studies reported its involvement in both spontaneous development of colorectal cancer and in colitis-associated colon cancer models .

  • Constitutive activity: Interestingly, high constitutive G protein signaling activity of CYSLTR2 mutants (a related receptor) has been associated with uveal melanoma and other cancer types, though the role of CYSLTR receptors in cancer remains complex and sometimes contradictory .

What is known about CYSLTR1's role in bone metabolism?

Studies investigating CYSLTR1's role in bone metabolism have yielded important insights:

What therapeutic approaches target CYSLTR1 in inflammatory conditions?

Several therapeutic approaches targeting CYSLTR1 have been developed:

  • FDA-approved antagonists:

    • Montelukast

    • Zafirlukast

    • Pranlukast

    These selective CYSLTR1 antagonists are widely prescribed as antiasthmatic drugs and for allergic rhinitis .

  • Mechanism of action: Crystal structures of CYSLTR1 bound to zafirlukast and pranlukast have revealed their binding modes, showing:

    • Lateral ligand access to the orthosteric pocket between transmembrane helices TM4 and TM5

    • Specific interactions with key residues in the binding pocket

  • Emerging applications:

    • SLE treatment: Montelukast ameliorated SLE manifestations in mouse models

    • Cancer therapy: Targeting CYSLTR1 in certain cancers where it influences progression

    • Neurodegenerative disorders: CysLTR2-selective or CysLTR1/CysLTR2 dual antagonists show promise for brain injury and neurodegenerative conditions

  • Limitations: Current antagonists demonstrate low effectiveness in some patients and exhibit various side effects, highlighting the need for more targeted approaches .

The reported crystal structures of CYSLTR1 provide important templates for rational discovery of safer and more effective drugs with desired selectivity profiles .

What approaches are used to generate recombinant CYSLTR1 protein for research?

Researchers use several methods to produce recombinant CYSLTR1 protein:

  • Expression systems:

    • E. coli: The full-length human CYSLTR1 (1-337aa) can be expressed in E. coli with an N-terminal His tag .

    • Mammalian cells: For functional studies requiring proper folding and post-translational modifications.

    • Insect cells: Used for structural studies requiring higher protein yields with eukaryotic processing.

  • Purification strategies:

    • Affinity chromatography using His-tag

    • Size exclusion chromatography

    • Crystallization procedures for structural studies

  • Storage considerations:

    • Recommended storage at -20°C/-80°C

    • Lyophilized forms with 6% Trehalose in Tris/PBS-based buffer, pH 8.0

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for long-term storage

    • Avoiding repeated freeze-thaw cycles

  • Quality control:

    • SDS-PAGE to confirm purity (>90%)

    • Functional assays to verify ligand binding and signaling activity

What are the most effective methods for generating CYSLTR1 knockout models?

CRISPR-Cas9 has emerged as the preferred method for generating CYSLTR1 knockout models, as demonstrated in recent studies:

  • Target design:

    • Selection of highly specific target sequences (sgRNAs) using software like CRISPRdirect

    • Targeting coding regions, particularly exon 4 of Cysltr1

    • Careful screening for potential off-target effects in genes like Plcl1, Pde10a, Mcc, and Ppargc1b

  • CRISPR-Cas9 delivery:

    • Electroporation of Cas9/sgRNA complexes into one-cell fertilized eggs

    • Parameters: 30V (3 msec ON + 97 msec OFF) × 6 (±) using an electroporator

  • Verification strategies:

    • PCR genotyping (for example, a 112-bp deletion mutation was detected)

    • DNA sequencing to confirm frameshift or in-frame mutations

    • Sequencing of potential off-target sites to ensure specificity

    • Functional validation through calcium flux assays in response to LTD4

  • Types of mutations generated:

    • Frameshift mutations resulting in premature stop codons (Cysltr1 KO)

    • In-frame deletions affecting critical domains like the first extracellular loop (Cysltr1 Δ105)

The generation of multiple types of mutations (null and domain-specific) allows for more comprehensive functional studies of CYSLTR1.

What experimental approaches are used to study CYSLTR1 signaling?

Researchers employ various techniques to investigate CYSLTR1 signaling:

  • Calcium mobilization assays:

    • Intracellular calcium flux measurements in response to ligands like LTD4

    • Used to assess receptor functionality and ligand potency

    • Particularly valuable for validating knockout or mutant receptors

  • Phosphoinositide (PI) production assays:

    • Measuring phosphoinositide generation following receptor activation

    • Evaluating effects of inhibitors or mutations on signaling intensity

  • Receptor internalization studies:

    • Tracking receptor trafficking after ligand binding

    • Comparing wild-type and mutant receptors to identify domains critical for internalization

    • Investigating the effects of kinase inhibitors on receptor trafficking

  • Transcriptomic analysis:

    • RNA-seq to identify genes regulated by CYSLTR1 signaling

    • Co-expression analysis to construct gene networks associated with CYSLTR1 function

    • Enrichment analysis to identify pathways affected by CYSLTR1 activation or inhibition

  • Inhibitor studies:

    • Using selective antagonists (montelukast, zafirlukast, pranlukast)

    • Applying pathway-specific inhibitors (PI3K and mTOR inhibitors)

    • Comparing effects in wild-type versus receptor-deficient systems to distinguish on-target from off-target effects

These methods collectively provide a comprehensive picture of CYSLTR1 signaling mechanisms and their physiological consequences.

How does the structure of CYSLTR1 determine ligand selectivity and antagonist design?

Advanced structural studies have provided crucial insights into CYSLTR1 ligand selectivity:

  • Crystal structures: Structures of CYSLTR1 bound to antagonists (zafirlukast and pranlukast) have revealed:

    • Unique ligand-binding modes with lateral access to the orthosteric pocket between TM4 and TM5

    • An atypical pattern of microswitches involved in receptor activation

    • A distinct four-residue-coordinated sodium site that influences receptor conformation

  • Structure-activity relationships:

    • Comprehensive mutagenesis studies have identified key residues determining ligand selectivity

    • Computer modeling accurately recapitulates binding of dozens of known ligands

    • Structure-based explanations for structure-activity relationships of 3,4-dihydro-2H-1,4-benzoxazine-2-carboxylic acid scaffold derivatives

  • Receptor selectivity determinants:

    • Molecular comparison between CYSLTR1 and CYSLTR2 has revealed critical differences in binding pockets

    • These differences explain the selectivity profiles of various antagonists

    • Provide templates for designing receptor-selective or dual antagonists with desired properties

  • Disease-related variants:

    • Structural studies have shed light on the effects of disease-related single nucleotide variants on receptor function

    • Help explain how mutations alter receptor signaling in conditions like asthma

These structural insights serve as templates for rational design of new generation antagonists with improved selectivity and efficacy profiles.

What is the relationship between CYSLTR1 and autophagy regulation?

Recent research has uncovered intriguing connections between CYSLTR1 and autophagy:

  • CYSLTR1 inhibition and autophagy induction:

    • CYSLTR1 antagonist application increases autophagic flux in retinal pigment epithelial cells (ARPE-19)

    • This effect has been observed with antagonists like zafirlukast (ZK)

  • Cellular consequences:

    • CYSLTR1 inhibition for 24 hours using zafirlukast decreased quantities of:

      • Autophagosomes

      • Late endosomes/lysosomes

      • Aggregated proteins

      • Reactive oxygen species (ROS)

  • Cell surface expression correlations:

    • Cells expressing CYSLTR1 on the surface (SE+) showed increased levels of:

      • Autophagosomes

      • Late endosomes/lysosomes

      • Aggregated proteins

      • Autophagy activity

    • These cells simultaneously displayed decreased ROS formation

  • Implications for cellular aging:

    • High levels of plasma membrane-localized CYSLTR1 indicate increased amounts of aggregated protein

    • This appears to raise the rate of autophagic flux as a compensatory mechanism

    • CYSLTR1 antagonism potentially mimics physiological conditions observed in CYSLTR1 SE+ cells

    • This mechanism could potentially dampen cellular aging processes

These findings suggest CYSLTR1 inhibition may have therapeutic potential beyond inflammatory conditions, particularly in disorders associated with protein aggregation.

What are the emerging roles of CYSLTR1 in non-inflammatory processes?

Beyond its well-established role in inflammation, CYSLTR1 is emerging as a regulator of several non-inflammatory processes:

  • Cellular homeostasis and protein quality control:

    • CYSLTR1 inhibition reduces levels of aggregated proteins in cells

    • The receptor influences the endosomal-lysosomal system (ELS) function

    • May affect cellular waste degradation via autophagy regulation

  • Cancer biology beyond inflammation:

    • CYSLTR1 expression levels correlate with survival outcomes in breast cancer

    • The receptor may influence cancer cell proliferation, migration, or other tumorigenic processes

    • Expression patterns may serve as prognostic markers in certain cancer types

  • B cell differentiation and antibody production:

    • CYSLTR1 modulates B cell differentiation through the BCL6-BLIMP1-XBP1 transcriptional axis

    • This affects antibody-secreting cell development independent of acute inflammatory responses

    • Suggests a role in normal humoral immunity regulation

  • Potential neuroprotective effects:

    • CYSLTR2-selective or CYSLTR1/CYSLTR2 dual antagonists show promise for brain injury and neurodegenerative disorders

    • May involve mechanisms beyond classical inflammatory pathways

  • Metabolic regulation:

    • Emerging evidence suggests CYSLTR1 may influence metabolic processes

    • Further investigation needed to fully characterize these functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.