Recombinant Human Cytochrome b5 type B (CYB5B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYB5B; CYB5M; OMB5; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-146
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Uniprot No.

Target Background

Function

Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for several membrane-bound oxygenases.

Gene References Into Functions
  1. A comparison of human and rat CYB5B X-ray crystal structures reveals a significant difference in packing involving the five-strand beta-sheet, attributable to the fully buried residue 21 in strand beta4. PMID: 21574570
  2. The 21 kDa protein overexpressed in Hodgkin Lymphoma and aggressive non-Hodgkin Lymphomas is identical to CYB5B. PMID: 20100355
  3. CYB5B may be involved in the differential modulation of 17α-hydroxylase and 17,20-lyase activities of P450c17 [type 2 cyt-b5]. PMID: 11867265
  4. Microsomal cytochrome b5 interacts with the neuronal calcium sensor protein visinin-like protein-3 in a Ca2+-dependent manner. PMID: 14739275
Database Links

HGNC: 24374

OMIM: 611964

KEGG: hsa:80777

STRING: 9606.ENSP00000308430

UniGene: Hs.461131

Protein Families
Cytochrome b5 family
Subcellular Location
Mitochondrion outer membrane.

Q&A

Basic Research Questions

  • What is Recombinant Human Cytochrome b5 Type B and what are its structural characteristics?

    Recombinant Human Cytochrome b5 Type B (CYB5B) is a member of the cytochrome b5 family containing one cytochrome b5 heme-binding domain. It functions as an electron carrier for membrane-bound oxygenases. The commercially available recombinant protein is typically produced in mammalian expression systems, with the target gene encoding amino acids Lys12-Cys118 expressed with a 6His tag at the C-terminus. The protein has a molecular weight of approximately 14kD .

    CYB5B is primarily localized to the mitochondrion outer membrane, distinguishing it from its microsomal counterpart (CYB5A) . Structurally, cytochrome b5 proteins like CYB5B contain transmembrane regions at the C-terminus that are critical for proper subcellular localization and function, as demonstrated in studies of similar proteins such as CybE in Aspergillus fumigatus .

  • What biological systems and pathways involve CYB5B?

    CYB5B participates in several critical biological pathways:

    • In mitochondria and aerobic prokaryotes, cytochrome b is a component of respiratory chain complex III (also known as the bc1 complex or ubiquinol-cytochrome c reductase)

    • CYB5B is part of the N-reductive system along with mitochondrial amidoxime reducing component (mARC) and cytochrome b5 reductase (CYB5R)

    • This N-reductive system is regulated by metabolic conditions such as fasting and high-fat diet in mice, suggesting its involvement in metabolic pathways

    • Similar cytochrome b5 proteins (such as CybE in fungi) play crucial roles in maintaining membrane fluidity and the accumulation of sterol-rich plasma membrane domains, which are essential for normal cellular growth

  • How does CYB5B function as an electron donor?

    CYB5B functions as an electron carrier that transfers electrons to various enzymes and substrates. The mechanism involves:

    1. Receiving electrons from reducing agents such as NADH via cytochrome b5 reductase (CYB5R)

    2. Transferring these electrons through its heme-binding domain to terminal electron acceptors

    3. Supporting the activity of various enzymes, particularly cytochrome P450 enzymes

    In systems like the N-reductive pathway, CYB5B operates alongside mARC and CYB5R proteins to form a complete electron transport chain . Studies of similar cytochrome b5 proteins in fungi have shown that they fuel the activity of ergosterol biosynthesis-related P450 enzymes (P450s) by providing electrons necessary for their catalytic function .

Advanced Research Questions

  • What are the optimal expression systems and purification strategies for generating functional recombinant CYB5B?

    For producing high-quality recombinant CYB5B:

    • Expression System: Mammalian expression systems are preferred for human CYB5B to ensure proper folding and post-translational modifications. The recombinant protein typically includes amino acids Lys12-Cys118 with a 6His tag at the C-terminus .

    • Purification Strategy:

      1. Metal affinity chromatography leveraging the 6His tag

      2. Size exclusion chromatography to enhance purity

      3. Endotoxin removal (ensuring levels below 0.1 ng/μg or 1 IEU/μg for research applications)

    • Quality Control:

      ParameterSpecificationMethod
      Purity>95%SDS-PAGE
      Endotoxin<0.1 ng/μgLAL test
      Biological activityElectron transfer capabilityFunctional assays
      IdentityMatches predicted MW (14kD)Mass spectrometry

    When expressing transmembrane proteins like CYB5B, it's critical to preserve the C-terminal transmembrane domains, as these are essential for proper subcellular localization and function, as demonstrated in studies of similar proteins .

  • How can researchers effectively generate CYB5B knockout models using CRISPR technology?

    For generating CYB5B knockout models using CRISPR:

    1. gRNA Selection: Multiple gRNA sequences have been designed by Feng Zhang's laboratory to uniquely target the CYB5B gene with minimal off-target effects. Researchers should ideally use at least two different gRNA constructs to increase success rates .

    2. Vector Selection: Use vectors that contain all elements required for gRNA expression: U6 promoter, spacer (target) sequence, gRNA scaffold, and terminator. Consider vectors with selection markers for easier screening .

    3. Validation Strategy:

      • Genomic PCR and sequencing to confirm targeted modifications

      • Western blotting to verify protein knockout

      • Functional assays to confirm loss of CYB5B activity

    4. Important Considerations:

      • Verify gRNA sequences against your specific target gene sequence

      • Consider targeting specific exons if studying splice variants

      • Be aware that compensatory mechanisms involving other electron donors (like cytochrome P450 reductase) may partially rescue phenotypes, as observed in studies of similar proteins

  • What are the tissue-specific and subcellular localization patterns of CYB5B, and how do they influence experimental design?

    CYB5B exhibits specific localization patterns that impact experimental approaches:

    • Subcellular Localization: CYB5B is primarily found in the mitochondrion outer membrane . This distinct localization differentiates it from microsomal cytochrome b5 (CYB5A) and influences its interaction partners and functions.

    • Membrane Association: The C-terminus contains transmembrane domains critical for proper localization. Studies of similar proteins show that deletion of these regions results in mislocalization and functional defects .

    • Experimental Implications:

      1. Cell fractionation protocols must carefully separate mitochondrial from microsomal fractions

      2. Immunofluorescence studies require specific antibodies that distinguish between CYB5B and CYB5A

      3. When creating tagged versions, C-terminal tags may interfere with membrane insertion and function

      4. Protein extraction requires detergent-based methods suitable for membrane proteins

    • Functional Consequences: The mitochondrial localization positions CYB5B to participate in respiratory chain activities and suggests potential roles in mitochondrial energy metabolism that differ from those of microsomal cytochrome b5 .

Experimental Methodology

  • What are the most effective methods for studying CYB5B-protein interactions and identifying novel binding partners?

    To study CYB5B interactions and identify binding partners:

    1. Co-immunoprecipitation (Co-IP):

      • Use antibodies against CYB5B or its tags (e.g., 6His) to pull down protein complexes

      • Include appropriate controls (IgG, non-expressing cells)

      • Consider crosslinking to capture transient interactions

    2. Proximity Labeling:

      • BioID or APEX2 fusions to CYB5B can identify proximal proteins in the native subcellular environment

      • Particularly valuable for membrane proteins like CYB5B that may have transient interactions

    3. Yeast Two-Hybrid Adaptations:

      • Split-ubiquitin systems designed for membrane proteins

      • MYTH (Membrane Yeast Two-Hybrid) system

    4. Mass Spectrometry-Based Approaches:

      • Protein complex pulldown followed by LC-MS/MS

      • SILAC or TMT labeling for quantitative comparison

    Studies of similar proteins have used pulldown assays to reveal interactions with proteins involved in lipid metabolism and transfer, cytoskeleton construction, and mitochondria-associated energy metabolism . When designing interaction studies, consider that CYB5B may participate in complexes with mARC proteins and cytochrome b5 reductase as part of the N-reductive system .

  • How can researchers assess the electron transfer function of CYB5B in different experimental systems?

    To evaluate CYB5B's electron transfer capabilities:

    1. Spectrophotometric Assays:

      • Monitor changes in absorption spectra (typically at 424 nm) during reduction/oxidation cycles

      • Use artificial electron acceptors like ferricyanide or cytochrome c

      • Compare electron transfer rates with and without potential substrates

    2. Reconstituted Systems:

      • Combine purified CYB5B with CYB5R (reductase) and terminal acceptors

      • Measure NADH consumption as an indirect measure of electron flow

      • Add potential physiological substrates to assess specificity

    3. Cellular Systems:

      • Create CYB5B variants with mutations in the heme-binding domain

      • Assess rescue of phenotypes in CYB5B-deficient cells

      • Use fluorescent redox indicators to visualize electron transfer in living cells

    4. Measuring Impact on Dependent Pathways:

      • Assess changes in cytochrome P450 activity

      • Measure alterations in sterol composition, as cytochrome b5 proteins support sterol biosynthesis

      • Evaluate membrane fluidity, which depends on proper sterol distribution

  • What strategies exist for studying the regulation of CYB5B under different metabolic conditions?

    To study CYB5B regulation under varying metabolic conditions:

    1. Animal Models:

      • Studies have shown that the N-reductive system including cytochrome b5 is regulated by fasting and high-fat diet in mice

      • Use controlled dietary interventions (fasting, high-fat diet, ketogenic diet)

      • Analyze tissue-specific changes in CYB5B expression and activity

    2. Cell Culture Models:

      • Subject cells to nutrient deprivation or excess

      • Mimic fasting using serum starvation or glucose limitation

      • Simulate high-fat conditions using lipid supplementation

    3. Analytical Approaches:

      • qRT-PCR and Western blotting to quantify transcript and protein levels

      • ChIP-seq to identify transcriptional regulators

      • Proteomics to identify post-translational modifications

    4. Functional Readouts:

      • Measure electron transfer activity under different conditions

      • Assess changes in dependent pathways (e.g., sterol biosynthesis)

      • Evaluate membrane properties, as cytochrome b5 proteins influence membrane fluidity and the formation of specialized membrane domains

    When designing such studies, consider the potential for compensatory mechanisms involving other electron donors, as observed in studies where cytochrome P450 reductase could partially rescue defects caused by cytochrome b5 deficiency .

Data Interpretation and Troubleshooting

  • How should researchers interpret observed phenotypes in CYB5B-deficient models and distinguish direct from indirect effects?

    When interpreting phenotypes in CYB5B-deficient models:

    1. Distinguishing Direct vs. Indirect Effects:

      • Compare with phenotypes of deficiencies in known interaction partners (mARC, CYB5R)

      • Use complementation studies with wild-type CYB5B and domain-specific mutants

      • Perform time-course analyses to identify primary vs. secondary effects

    2. Considering Compensatory Mechanisms:

      • Assess upregulation of alternative electron donors like cytochrome P450 reductase (CPR)

      • Studies of similar proteins show that overexpression of CPR can significantly rescue growth defects caused by cytochrome b5 deficiency

      • Examine changes in related pathways that might compensate for lost function

    3. Membrane-Related Phenotypes:

      • CYB5B deficiency may affect membrane properties through impacts on sterol metabolism

      • Analyze membrane fluidity, which can be decreased in cytochrome b5-deficient cells

      • Examine the distribution of sterol-rich domains, which support the assembly of growth machinery and signaling complexes

    4. Metabolic Consequences:

      • Investigate alterations in metabolic pathways regulated by the N-reductive system

      • Consider that CYB5B regulation is linked to metabolic states like fasting and high-fat diet

      • Assess mitochondrial function, as CYB5B is localized to the mitochondrial outer membrane

  • What are common pitfalls in CYB5B research and how can they be avoided?

    Common pitfalls and solutions in CYB5B research:

    1. Protein Expression and Purification Challenges:

      • Pitfall: Loss of function due to improper folding or heme incorporation

      • Solution: Verify heme content spectrophotometrically; use expression systems that support proper folding and post-translational modifications

    2. Localization Issues:

      • Pitfall: Mislocalization of tagged or truncated constructs

      • Solution: C-terminal tags may interfere with transmembrane domains; use N-terminal tags or internal tags, and always validate localization

    3. Functional Redundancy:

      • Pitfall: Minimal phenotype in knockout models due to compensation

      • Solution: Consider double knockouts of CYB5B and potential compensatory proteins; use acute depletion methods to minimize adaptation

    4. Specificity in Assays:

      • Pitfall: Inability to distinguish between different cytochrome b5 isoforms

      • Solution: Use isoform-specific antibodies; validate specificity with knockout controls; consider MS-based approaches for absolute specificity

    5. Membrane Protein Challenges:

      • Pitfall: Poor solubilization leading to aggregation or loss of interacting partners

      • Solution: Optimize detergent types and concentrations; consider native membrane systems or nanodiscs for interaction studies

  • How can contradictory data in CYB5B research be reconciled and what approaches help resolve experimental inconsistencies?

    Approaches to reconcile contradictory data in CYB5B research:

    1. Cell Type and Tissue Specificity:

      • Determine if contradictions arise from different cell types or tissues

      • CYB5B may have tissue-specific functions or regulation patterns

      • Systematically compare expression levels across relevant tissues

    2. Experimental Conditions:

      • Metabolic states significantly influence the N-reductive system including CYB5B

      • Standardize nutritional conditions when comparing across studies

      • Consider that fasting states vs. fed states may yield different results

    3. Functional Redundancy Analysis:

      • Assess the expression and activity of other electron donors like CPR

      • Studies show that overexpression of CPR can compensate for cytochrome b5 deficiency

      • Create a comprehensive profile of electron transfer proteins in your model system

    4. Methodology Comparisons:

      • Table: Comparing Methods for CYB5B Functional Analysis

      MethodStrengthsLimitationsBest Applications
      In vitro reconstitutionDefined componentsMay not reflect in vivo conditionsMechanistic studies
      Cell-based assaysPhysiological contextComplex interactionsPhenotypic analysis
      Animal modelsSystem-level effectsSpecies differencesMetabolic regulation
      CRISPR knockoutComplete loss of functionPotential compensationGenetic requirement
      Domain mutationsSpecific function disruptionExpression challengesStructure-function
    5. Integrative Approaches:

      • Combine multiple methodologies to address the same question

      • Use computational modeling to integrate disparate data sets

      • Consider systems biology approaches to place contradictory findings in context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.