Recombinant Human Probable transmembrane reductase CYB561D1 (CYB561D1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanisms

CYB561D1 functions as a transmembrane reductase with two primary activities:

  1. Electron Transfer:

    • Utilizes cytoplasmic ASC as an electron donor to reduce luminal MDA or Fe³⁺, facilitating ASC regeneration and iron uptake .

    • Operates via sequential oxidation and reduction of HP and LP hemes, enabling trans-membrane electron transport .

  2. Iron Reductase Activity:

    • Critical for cellular iron metabolism, reducing ferric iron (Fe³⁺) to ferrous iron (Fe²⁺) for transport and utilization .

Biochemical and Spectroscopic Properties

Recombinant CYB561D1 (studied in mouse orthologs) exhibits distinct redox and spectral characteristics:

Table 1: Key Properties of Recombinant CYB561D1 (Mouse Ortholog)

PropertyValue/ObservationMethod/Source
Heme Spin StateHighly asymmetric low-spin (HALS)EPR spectroscopy
Midpoint Redox PotentialsHP heme: ~160 mV; LP heme: ~20 mVRedox titration
Ascorbate BindingHigh-affinity site: 0.045 mM; Low-affinity site: 2.34 mMSpectrophotometry
EPR SignalsDominant g-values at 3.69 (HP heme)EPR spectroscopy

Key findings:

  • No exciton coupling between hemes, suggesting independent redox centers .

  • Reduction by ASC follows biphasic kinetics, with distinct binding affinities for ASC at two sites .

Research Implications and Pathological Relevance

While human CYB561D1-specific studies are sparse, its homologs and orthologs suggest roles in:

  • Cancer Biology:

    • CYB561 family members like CYB561D2 (101F6) exhibit tumor-suppressive or oncogenic roles depending on tissue context .

    • Differential expression in tumors (e.g., glioma, lung cancer) correlates with prognosis .

  • Neurological and Metabolic Functions:

    • Linked to cognitive function, diabetes, and aging in mouse models .

Future Directions

  • Human-Specific Studies: Structural and functional characterization of recombinant human CYB561D1 remains a priority.

  • Therapeutic Targeting: Potential for modulating CYB561D1 in iron-related disorders or cancers, leveraging its redox and reductase activities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. Should you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for customers.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CYB561D1; Probable transmembrane reductase CYB561D1; Cytochrome b561 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CYB561D1
Target Protein Sequence
MQPLEVGLVPAPAGEPRLTRWLRRGSGILAHLVALGFTIFLTALSRPGTSLFSWHPVFMA LAFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRTRSEL PHLVSWHSWVGALTLLATAVQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVT VLLGMYSVWFQAQIKGAAWYLCLALPVYPALVIMHQISRSYLPRKKMEM
Uniprot No.

Target Background

Function
This probable transmembrane reductase likely utilizes ascorbate as an electron donor. It transfers electrons across membranes, reducing monodehydro-L-ascorbate radical and iron cations Fe(3+) in different cellular compartments.
Database Links

HGNC: 26804

KEGG: hsa:284613

UniGene: Hs.514682

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of CYB561D1 and how does it differ from other CYB561 family members?

CYB561D1 is a transmembrane protein belonging to the cytochrome b561 family characterized by redox centers positioned on opposite sides of the host membrane. Like other members of this family, it contains two heme-b centers that facilitate electron transfer across membranes. Spectroscopic analysis of the mouse ortholog (Mm_CYB561D1) reveals no detectable electronic interaction between these two heme-b centers, as demonstrated by circular dichroism spectroscopy .

Unlike some other CYB561 proteins that show distinct spectral differences between the two hemes, recombinant Mm_CYB561D1 shows near identical spectra for both heme centers . Both hemes in CYB561D1 demonstrate a highly asymmetric low-spin (HALS) character, which is an important distinguishing feature of this protein .

What are the redox properties of CYB561D1?

CYB561D1 possesses two heme-b centers with different midpoint reduction potentials. Based on studies of the mouse ortholog, these potentials were measured at approximately 144 ± 7 mV and -19 ± 4 mV . This difference in reduction potentials (~163 mV) is larger than typically observed in other CYB561 proteins, although some publications have reported differences as high as ~150 mV in related proteins .

The protein contains two putative ascorbate binding sites with comparable binding constants to other members of the CYB561 protein family. When reduced by increasing concentrations of ascorbate (at pH 7), it shows a pattern similar to other CYB561 proteins .

Where is CYB561D1 expressed in normal tissues?

The expression pattern of CYB561D1 varies across tissues. In mice, the Cyb561d1 gene shows highest expression in the thymus, spleen, colon, and large intestine . This tissue-specific expression pattern suggests specialized functions in immune and digestive systems.

In contrast to some other CYB561 family members that are localized to membranes involved in bioenergization, CYB561D1 and other family proteins are found in different cellular membranes . This diverse localization correlates with their varied biological functions.

What are the recommended methods for recombinant expression and purification of CYB561D1?

When planning purification protocols, it's important to note that yeast membranes typically contain minimal ascorbate-reducible cytochromes and only a small amount of dithionite-reducible ones, which is advantageous for spectroscopic and redox titration experiments .

What antibodies and detection methods are available for studying CYB561D1?

Commercially available antibodies for CYB561D1 detection include polyclonal antibodies generated from rabbits immunized with KLH-conjugated synthetic peptides from the C-terminal region (amino acids 200-229) of human CYB561D1 . These antibodies are suitable for multiple applications:

  • Western Blot: Recommended dilution 1:100-500

  • Immunohistochemistry: Recommended dilution 1:50-100

  • Flow Cytometry: Recommended dilution 1:10-50

  • ELISA: Recommended dilution 1:1,000

For optimal results, antibodies should be stored at -20°C with aliquoting to avoid repeated freeze-thaw cycles. Before use, centrifugation of the original vial after thawing is recommended for maximum product recovery .

What spectroscopic methods are most informative for characterizing CYB561D1?

Several complementary spectroscopic approaches have proven valuable for characterizing CYB561D1:

  • UV-Visible Spectroscopy: Useful for basic characterization and redox state determination, including monitoring changes during ascorbate titration experiments .

  • Circular Dichroism (CD) Spectroscopy: Particularly valuable for examining potential electronic interactions between the two heme-b centers in both oxidized and reduced states. For Mm_CYB561D1, CD spectra between 380 and 600 nm revealed minimal exciton splitting, indicating limited electronic interaction between the heme centers .

  • Electron Paramagnetic Resonance (EPR): Important for determining the spin state characteristics of the heme centers. EPR analysis of Mm_CYB561D1 demonstrated that both hemes possess a highly asymmetric low-spin (HALS) character, with no significant peak around gz = 3.16 (typically associated with rhombic heme environments in other cytochrome b561 proteins) .

  • Singular Value Decomposition (SVD) Analysis: This mathematical approach can be applied to spectral matrices obtained from titration experiments to reveal the presence of distinct spectral components and their relationships .

What is the relationship between CYB561D1 and cancer pathology?

The CYB561 family, including CYB561D1, has been implicated in cancer pathology. The related protein CYB561 is highly expressed in castration-resistant prostate cancer (CRPC) and appears to play a role in neuroendocrine (NE) differentiation processes that drive progression of the aggressive NE phenotype in this cancer type .

CYB561 is constitutively expressed in neuroendocrine cells and is involved in:

  • α-amidation-dependent activation of neuropeptides

  • Regulation of iron metabolism (which is often dysregulated in cancer)

Research has shown that CYB561 expression is upregulated in metastatic and NE prostate cancer tumors and cell lines compared to normal prostate epithelia, with expression independent of androgen regulation . While these findings specifically relate to CYB561, they suggest potential areas for investigation regarding CYB561D1's role in cancer, particularly given the family relationship between these proteins.

How does CYB561D1 contribute to cellular iron homeostasis?

Research on the related protein CYB561 provides insight into potential roles of CYB561D1 in iron metabolism. Knockdown of CYB561 in prostate cancer cell models reduced intracellular ferrous iron concentration . In androgen-deprived LNCaP cells, CYB561 depletion dampened transdifferentiation-induced increases in iron levels .

These findings suggest that CYB561 family proteins, potentially including CYB561D1, play important roles in cellular iron homeostasis. The transmembrane electron transfer capability of these proteins likely contributes to their function in iron metabolism, possibly by facilitating redox reactions required for iron transport or utilization.

Advanced research questions might investigate whether CYB561D1 specifically impacts iron transport proteins, ferritin levels, or iron-dependent enzymes, and whether these functions vary across different tissue types where CYB561D1 is highly expressed.

What are the predicted transmembrane electron transfer pathways in CYB561D1?

Homology modeling approaches have been used to generate putative 3D structures of CYB561D1 and predict likely transmembrane electron transfer pathways . These models suggest that electron transfer occurs between the two heme-b centers positioned on opposite sides of the membrane.

The redox titration experiments on Mm_CYB561D1 have been analyzed using complex models that account for both "null" (non-interacting) and "realistic" (partially interacting) scenarios between the two heme centers . These models provide insights into the electron transfer mechanism and help explain the observed midpoint reduction potentials.

Advanced research should focus on determining specific amino acid residues involved in the electron transfer pathway, including those that coordinate the heme groups and those that facilitate electron movement between them.

What compounds are known to modulate CYB561D1 expression?

Multiple compounds have been identified that affect Cyb561d1 expression in experimental models (primarily in rats and mice):

CompoundEffect on ExpressionExperimental Evidence
(+)-catechin (with Grape Seed Proanthocyanidins)DecreasedISO evidence from human CYB561D1
1,2-dichloroethaneDecreasedISO evidence from mouse Cyb561d1
1,2-dimethylhydrazineIncreasedISO evidence from mouse Cyb561d1
2,2',4,4'-Tetrabromodiphenyl etherIncreasedDirect experimental evidence
2,3,7,8-tetrachlorodibenzodioxineIncreasedISO evidence from mouse Cyb561d1
2,4-dinitrotolueneAffects (unspecified direction)Direct experimental evidence
2-hydroxypropanoic acid (Lactic Acid)DecreasedISO evidence from human CYB561D1
4,4'-sulfonyldiphenol (bisphenol S)DecreasedISO evidence from mouse Cyb561d1
5-aza-2'-deoxycytidine (Decitabine)Affects (unspecified direction)ISO evidence from human CYB561D1
6-propyl-2-thiouracil (Propylthiouracil)DecreasedDirect experimental evidence

This data suggests that CYB561D1 expression is responsive to various environmental and pharmacological agents, including some with known endocrine-disrupting properties.

How do experimental conditions affect the spectral and redox properties of recombinant CYB561D1?

The spectral and redox properties of recombinant CYB561D1 can be influenced by several experimental factors:

  • Buffer Composition: Studies on Mm_CYB561D1 used 50 mM phosphate buffer (pH 7.0) containing 0.5 mM dodecyl maltoside (DDM) for spectroscopic measurements . The choice of buffer, pH, and detergent can significantly impact protein stability and spectral characteristics.

  • Redox Environment: Titration with varying concentrations of ascorbate revealed different reduction behaviors for the two heme centers . The experimental titration conditions, including the range of ascorbate concentrations used, can affect the determination of midpoint potentials.

  • Purification Method: The degree of protein purity influences spectroscopic measurements. The A(280 nm)-to-A(Soret peak) ratio serves as an indicator of purity, with higher values indicating lower purity .

  • Expression System: The choice of expression system (e.g., yeast) may influence post-translational modifications and folding of the recombinant protein, potentially affecting its spectral and redox properties .

Researchers should carefully control these variables to ensure reproducible characterization of CYB561D1's properties.

What are the main challenges in studying CYB561D1 function in cellular contexts?

Several challenges exist when investigating CYB561D1 function in cellular contexts:

  • Functional Redundancy: The presence of multiple CYB561 family members in mammalian cells may create functional redundancy, complicating the interpretation of knockdown or knockout studies .

  • Purification Difficulties: Complete purification of recombinant CYB561D1 has proven challenging, as indicated by the relatively high A(280 nm)-to-A(Soret peak) ratio observed in partially purified samples .

  • Complex Redox Behavior: The presence of two heme centers with different redox potentials necessitates sophisticated analytical approaches to fully characterize electron transfer pathways and kinetics .

  • Tissue-Specific Functions: The varied expression patterns across tissues suggest potential organ-specific functions that may require specialized experimental systems to investigate properly .

  • Integration with Other Cellular Pathways: Understanding how CYB561D1 interacts with other cellular processes, such as iron metabolism and neuropeptide processing, requires multidisciplinary approaches .

What methodological advances would enhance CYB561D1 research?

Several methodological advances could significantly enhance CYB561D1 research:

  • Improved Purification Protocols: Development of optimized purification methods to obtain higher purity recombinant CYB561D1 would facilitate more accurate biophysical characterization .

  • Tissue-Specific Conditional Knockout Models: These would allow investigation of CYB561D1 function in specific tissues while avoiding potential developmental effects of constitutive knockouts.

  • Advanced Spectroscopic Techniques: Application of time-resolved spectroscopy and other dynamic methods could provide insights into the kinetics of electron transfer and ascorbate interactions .

  • Cryo-EM or X-ray Crystallography: Structural determination at high resolution would enhance understanding of the protein's mechanism beyond what is possible with homology modeling approaches .

  • Systems Biology Approaches: Integration of CYB561D1 function into broader cellular networks, particularly in contexts such as cancer progression and iron metabolism, would provide a more comprehensive understanding of its biological roles .

What are the most significant open questions regarding CYB561D1 biology?

Despite progress in characterizing CYB561D1, several significant questions remain unanswered:

  • What are the specific physiological electron donors and acceptors for CYB561D1 in vivo, beyond the established ascorbate reducibility?

  • How does the protein's function vary across the diverse tissues where it is expressed (thymus, spleen, colon, and large intestine)?

  • What is the precise role of CYB561D1 in cancer pathology, given the established involvement of related family members in neuroendocrine differentiation and prostate cancer?

  • How do the two heme centers with different redox potentials coordinate their activities during electron transfer processes?

  • What specific roles does CYB561D1 play in iron metabolism and how does this function intersect with its electron transfer capabilities?

  • How is CYB561D1 expression regulated under normal physiological conditions and in disease states?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.