Recombinant Human Cytochrome b561 (CYB561)

Shipped with Ice Packs
In Stock

Description

Functional Roles

Recombinant CYB561 facilitates:

  • ASC Regeneration: Acts as a monodehydroascorbate reductase, recycling ASC to maintain cellular antioxidant capacity .

  • Iron Reduction: Serves as a ferric reductase, providing Fe²⁺ for transmembrane transport and metabolism .

  • Electron Shuttling: Mediates electron transfer between cytosolic ASC and intravesicular acceptors (e.g., dopamine β-monooxygenase) .

Cancer

  • Tumor Promotion: Upregulated CYB561 expression in HER2-positive breast cancer enhances proliferation, migration, and iron uptake by modulating TFRC and DMT1 expression . Knockdown reduces tumorigenicity in xenograft models .

  • Tumor Suppression: 101F6 (CYB561D2) inhibits lung cancer growth when co-administered with ASC .

Neurological Disorders

  • Norepinephrine Synthesis: CYB561 deficiency disrupts catecholamine production, causing orthostatic hypotension .

  • Memory Retention: Drosophila CYB561 homologs (e.g., Nemy) are critical for memory function .

Research Applications

Recombinant CYB561 enables:

  • Spectroscopic Studies: EPR and optical spectroscopy reveal asymmetric low-spin heme environments (g₃ = 3.69) and redox properties .

  • Mutation Analysis: His-to-Ala mutations in heme-coordinating residues alter ASC reduction kinetics and protein stability .

Challenges and Future Directions

  • Expression Yield: Low natural abundance necessitates recombinant systems, but purification remains challenging due to contaminant proteins .

  • Therapeutic Targeting: Dual roles in tumor promotion/suppression require mechanistic clarity for clinical translation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CYB561; Transmembrane ascorbate-dependent reductase CYB561; Cytochrome b-561; Cytochrome b561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CYB561
Target Protein Sequence
MEGGAAAATPTALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIG LIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKKGYADLYSL HSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLK EALLFNLGGKYSAFEPEGVLANVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFK TLTEGDSPGSQ
Uniprot No.

Target Background

Function
Cytochrome b561 is a transmembrane reductase that utilizes ascorbate as an electron donor in the cytoplasm. It transfers electrons across membranes to reduce monodehydro-L-ascorbate radical within the lumen of secretory vesicles. This function plays a crucial role in ascorbate regeneration and homeostasis within secretory vesicles. In turn, this provides the reducing equivalents required to support the activity of intravesicular enzymes.
Gene References Into Functions
  1. We investigated the hereditary control of HR using a twin pair design, both at rest and during environmental (cold) stress. A single nucleotide polymorphism disruption of a microribonucleic acid (microRNA) recognition motif in the human CYB561 3'-UTR was identified. PMID: 24140660
  2. Structural features within the cyt b(561) family are well-conserved at both the sequence and protein levels. PMID: 12768339
  3. CYB561 is a senescene-associated gene in normal human oral keratinocytes. PMID: 12837283
Database Links

HGNC: 2571

OMIM: 600019

KEGG: hsa:1534

STRING: 9606.ENSP00000354028

UniGene: Hs.355264

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in many tissues, in particular the brain especially in the cortex and hippocampus.

Q&A

What is the basic structure and function of human CYB561?

Human Cytochrome b561 belongs to the B-type cytochrome family of electron transport proteins containing heme. The protein consists of 200-300 amino acids with approximately half embedded within the membrane bilayer . It contains two heme-b subunits that facilitate transmembrane electron transfer . CYB561 has a maximum absorbance wavelength in the redox absorption spectrum of approximately 561 nm, which is reflected in its name . Functionally, it serves as a monodehydroascorbate reductase that regenerates ascorbate and as a Fe³⁺-reductase, providing reduced iron for transmembrane transport . This transmembrane electron transfer capability is a defining characteristic of the protein family .

What expression systems are most effective for producing recombinant human CYB561?

Based on successful approaches with related cytochromes, yeast expression systems have proven effective for recombinant CYB561 production . For the mouse ortholog Mm_CYB561D1, yeast expression followed by solubilization with detergents such as n-dodecyl-β-D-maltoside (DDM) has yielded functional protein . Baculovirus-infected insect cell systems may also be viable, as demonstrated with related cytochromes . When selecting an expression system, researchers should consider:

  • Post-translational modifications required for proper heme incorporation

  • Membrane protein folding capabilities of the host

  • Ease of extraction and purification from host membranes

  • Potential for scale-up if larger quantities are needed

Importantly, DDM has shown superior efficiency for solubilizing functional CYB561 compared to other detergents, yielding higher specific content of ascorbate-reducible protein .

How can researchers verify the functional integrity of recombinant human CYB561?

Functional verification of recombinant CYB561 should include multiple spectroscopic approaches to confirm both structural integrity and electron transfer capabilities:

  • Optical Absorption Spectroscopy: Observe characteristic split α-bands in the spectrum of ascorbate-reduced protein (consistent with the presence of two heme pockets) . The presence of these split α-bands indicates that each heme is located in an anisotropic electrostatic field .

  • Ascorbate Reduction Assay: Measure the protein's response to increasing ascorbate concentrations. Functional CYB561 should show characteristic reduction patterns at specific ascorbate concentrations (K₁ ≈ 0.045 mM and K₂ ≈ 2.34 mM for related CYB561 proteins) .

  • Electron Paramagnetic Resonance (EPR): Analyze the protein's EPR spectrum to characterize the heme environments. Functional CYB561 typically shows highly asymmetric low-spin (HALS) character in both hemes .

  • Redox Titration: Determine midpoint redox potential values, which should range from +80 to +190 mV for the 'high potential' (HP) heme and -20 to +60 mV for the 'low potential' (LP) heme .

How can site-directed mutagenesis be used to investigate structure-function relationships in human CYB561?

Site-directed mutagenesis provides valuable insights into structure-function relationships of CYB561. Based on studies of related cytochromes, researchers should consider these strategic approaches:

  • Heme-Coordinating Histidine Residues: Target the highly conserved histidine residues that coordinate the hemes. Mutations in these residues can reveal their specific roles in electron transfer:

    • Mutations in LP-heme (intravesicular-side) coordinating histidines typically result in nearly undetectable protein levels

    • Mutations in HP-heme (cytosolic-side) coordinating histidines generally yield detectable protein but with altered ascorbate-reduction kinetics and reduced heme content

  • Conserved Lysine Residues: Mutations in these residues (such as K83 in maize CYB561B1) can alter midpoint redox potentials and ascorbate-reduction kinetics .

  • Loop Regions: Mutations in loop regions on the intravesicular side significantly decrease transmembrane Fe³⁺-reductase activity, while mutations on the cytoplasmic side have comparatively less effect .

The interpretation of mutagenesis results should consider both structural changes (protein stability and heme incorporation) and functional impacts (electron transfer efficiency and substrate interactions).

What methodologies can researchers use to study the electron transfer kinetics of human CYB561?

Advanced kinetic analysis of CYB561 electron transfer requires specialized techniques:

  • Stopped-Flow Spectroscopy: This technique allows measurement of the reduction kinetics of oxidized CYB561 with ascorbate. Researchers should monitor the reaction at different pH values (5.0-7.0) to assess pH dependency of electron transfer .

  • Pulse Radiolysis: This method enables determination of the second-order rate constant for electron donation from the ascorbate-reduced CYB561 to pulse-generated monodehydroascorbate radical. For comparison, human tumor suppressor 101F6 (a CYB561 homologue) shows a rate constant of 5.0 × 10⁷ M⁻¹s⁻¹, approximately 2-fold faster than bovine chromaffin granule cytochrome b561 .

  • Diethyl Pyrocarbonate Treatment: This treatment helps determine whether CYB561 utilizes a "concerted proton/electron transfer mechanism" by potentially inhibiting electron acceptance from ascorbate .

  • Singular Value Decomposition Analysis: This mathematical approach can identify distinct b-type heme spectra that can be assigned to the two CYB561 hemes .

Cytochrome VariantSecond-order Rate Constant (M⁻¹s⁻¹)pH DependencyDEPC Inhibition
Human 101F6 (CYB561 homologue)5.0 × 10⁷IndependentAbsent
Bovine chromaffin granule CYB561~2.5 × 10⁷DependentPresent
Zea mays CYB561~1.0 × 10⁷DependentPresent

How do research approaches differ when investigating CYB561's role in tumor suppression versus iron metabolism?

When investigating different physiological roles of CYB561, researchers should employ targeted experimental designs:

For Tumor Suppression Studies:

  • Focus on interactions with ascorbate, as tumor suppressor activity is enhanced in its presence .

  • Analyze expression patterns in various cancer cell lines compared to normal tissues.

  • Perform gene knockdown/overexpression studies to assess effects on proliferation, apoptosis, and related cellular processes.

  • Examine the relationship between CYB561D1/D2 expression and outcomes in clinical samples .

  • Investigate interactions with tumor-relevant signaling pathways, particularly those affected by redox status.

For Iron Metabolism Studies:

  • Focus on Fe³⁺-reductase activity using membrane-embedded protein.

  • Measure iron uptake in cellular models with manipulated CYB561 expression.

  • Assess interactions with iron transport proteins.

  • Examine regulation of CYB561 expression under iron-deficient and iron-loaded conditions.

  • Investigate tissue-specific expression patterns, particularly in tissues with high iron demand.

Both research directions benefit from comparative studies with related CYB561 family members, as functional differences may provide insights into specific physiological roles.

What are the major challenges in purifying recombinant human CYB561 and how can they be addressed?

Purification of membrane proteins like CYB561 presents several challenges:

  • Insufficient Solubilization:

    • Challenge: Many detergents fail to effectively extract CYB561 from membranes while maintaining functional integrity.

    • Solution: Use n-dodecyl-β-D-maltoside (DDM) as the preferred detergent, as it has shown superior results in solubilizing functional CYB561 compared to other detergents .

  • Incomplete Purification:

    • Challenge: His-tag affinity chromatography alone may not achieve homogeneity, as observed with mouse Mm_CYB561D1 .

    • Solution: Implement a multi-step purification strategy combining:

      • Affinity chromatography (His-tag)

      • Ion exchange chromatography

      • Size exclusion chromatography

  • Loss of Heme Groups:

    • Challenge: During purification, heme groups may dissociate from the protein.

    • Solution: Include heme precursors during expression and maintain reducing conditions throughout purification.

  • Protein Stability:

    • Challenge: Purified CYB561 may show decreased stability over time.

    • Solution: Optimize buffer composition (pH, salt concentration, glycerol content) and storage conditions (temperature, addition of reducing agents).

How can researchers effectively distinguish between different human CYB561 isoforms in experimental systems?

Distinguishing between CYB561 isoforms requires a combination of analytical approaches:

  • Spectroscopic Fingerprinting:
    Different CYB561 isoforms exhibit subtle differences in their spectral properties:

    • The fine structure of the split α-band differs between isoforms

    • Analyze these differences using high-resolution spectroscopy

  • Isoform-Specific Antibodies:

    • Develop antibodies targeting unique epitopes in different isoforms

    • Validate specificity using recombinant proteins and knockout cell lines

  • Kinetic Analysis:
    CYB561 isoforms show distinct electron transfer kinetics:

    • Measure ascorbate reduction rates at different pH values

    • Determine second-order rate constants for electron donation to monodehydroascorbate radical

    • Assess sensitivity to inhibitors

  • Expression Pattern Analysis:

    • Human CYB561D1 is detected in many tissues with varying expression levels

    • Mouse CYB561D1 shows highest expression in thymus, spleen, colon, and large intestine

    • Use tissue-specific expression patterns as supporting evidence

What biophysical techniques provide the most valuable structural information about human CYB561 in the absence of crystal structures?

In the absence of crystal structures, several biophysical techniques can provide valuable structural insights:

  • Homology Modeling:
    Given that atomic structures have been resolved for only two members of the CYB561 protein family (from Arabidopsis thaliana and human duodenal protein) , homology modeling offers a practical approach. This involves:

    • Template selection (using resolved structures as templates)

    • Sequence alignment and model building

    • Model validation through experimental data

  • Circular Dichroism (CD) Spectroscopy:
    CD spectroscopy can provide information about:

    • Secondary structure content (α-helices and β-sheets)

    • Conformational changes upon ligand binding

    • Thermal stability

  • EPR Spectroscopy:
    EPR provides detailed information about:

    • The electronic structure of the hemes

    • The coordination environment of the iron centers

    • Changes in heme environment upon reduction/oxidation

    • Distinction between highly asymmetric low-spin (HALS) and rhombic heme environments

  • Hydrogen-Deuterium Exchange Mass Spectrometry:
    This technique can identify:

    • Solvent-accessible regions of the protein

    • Conformational changes upon ligand binding

    • Dynamics of different protein regions

How can recombinant human CYB561 be used to investigate its potential role in neurological processes?

Investigating CYB561's neurological functions requires specialized approaches:

  • Neuronal Cell Models:

    • Express recombinant CYB561 in neuronal cell lines

    • Assess impact on neurotransmitter synthesis and packaging

    • Measure changes in ascorbate recycling and neuroprotection against oxidative stress

  • Synaptosome Preparations:

    • Isolate synaptosomes from neuronal tissues

    • Measure native CYB561 activity in these preparations

    • Compare with recombinant protein to validate functionality

  • Electrophysiological Studies:

    • Assess the impact of CYB561 on neuronal excitability

    • Investigate potential roles in memory formation pathways

    • Examine effects on neurotransmitter release

  • Animal Models:

    • Develop transgenic models with altered CYB561 expression

    • Perform behavioral tests related to memory and cognition

    • Assess molecular changes in brain tissue

Since physiological functions supported by CYB561s include various neurological processes, including memory retention , these approaches can provide valuable insights into the protein's role in brain function.

What methodologies are most appropriate for studying the interaction between human CYB561 and ascorbate in different cellular compartments?

Studying compartment-specific CYB561-ascorbate interactions requires specialized techniques:

  • Subcellular Fractionation:

    • Isolate different cellular compartments (plasma membrane, endosomes, secretory vesicles)

    • Measure CYB561 activity and ascorbate levels in each fraction

    • Compare activity profiles across compartments

  • Organelle-Targeted Ascorbate Sensors:

    • Develop fluorescent probes that report on ascorbate levels in specific compartments

    • Co-express with CYB561 to monitor real-time changes in ascorbate recycling

    • Use in combination with CYB561 knockdown/overexpression

  • In-vitro Reconstitution Systems:

    • Create proteoliposomes containing purified recombinant CYB561

    • Establish transmembrane ascorbate gradients

    • Measure electron transfer rates across the membrane

    • Assess how lipid composition affects activity

  • High-Resolution Microscopy:

    • Use immunofluorescence to localize CYB561 in cells

    • Correlate with ascorbate distribution

    • Implement super-resolution techniques for detailed colocalization studies

These approaches can help elucidate how CYB561 contributes to ascorbate recycling in different cellular compartments, which is crucial for understanding its diverse physiological roles.

How do the functional properties of human CYB561 compare with its orthologs from other species?

Comparative analysis reveals both conserved and species-specific properties:

SpeciesProteinSequence Similarity to HumanKey Functional Differences
MouseMm_CYB561D190% identity, 95% similarity Similar ascorbate reducibility, highly conserved function
BovineBt_CYB561A1High conservationPrototype member of the family, well-characterized chromaffin granule protein
ArabidopsisAt_CYB561B2Lower conservationPlant-specific adaptations, crystal structure available
Zea maysCYB561B1Lower conservationPlant-specific functions, slower electron donation rate to monodehydroascorbate radical

What experimental approaches can distinguish between the different human CYB561 family members (CYB561A, CYB561B, CYB561D)?

Distinguishing between human CYB561 family members requires multi-faceted approaches:

  • Spectroscopic Profiling:

    • Each family member exhibits distinct spectral properties

    • Analyze differences in split α-bands and EPR spectra

    • Create a spectroscopic fingerprint database for each variant

  • Kinetic Analysis:

    • CYB561 variants show different electron transfer kinetics:

      • CYB561D2 (101F6) demonstrates pH-independent reduction with ascorbate, unlike other family members

      • Measure rate constants for electron donation to monodehydroascorbate radical

      • Assess pH dependency profiles

  • Inhibitor Sensitivity:

    • Diethyl pyrocarbonate treatment affects family members differently:

      • No inhibition observed for 101F6 (CYB561D2)

      • Other family members show sensitivity

    • Develop a panel of selective inhibitors

  • Tissue Distribution Analysis:

    • Expression patterns differ across tissues:

      • Human CYB561D1 is detected in many tissues

      • Mouse CYB561D1 shows highest expression in thymus, spleen, colon, and large intestine

    • Use tissue-specific expression as supporting evidence

These approaches collectively provide a comprehensive framework for distinguishing between different human CYB561 family members in experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.