Recombinant Human Cytochrome b5 (CYB5A)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Cytochrome b5 (CYB5A)

Recombinant Human Cytochrome b5, also known as CYB5A, is a membrane-bound hemoprotein that functions as an electron carrier for several membrane-bound oxygenases. It is crucial in various biological processes, including the metabolism of drugs and steroids, and plays a significant role in the cytochrome P450 (CYP) enzyme system. CYB5A contains one cytochrome b5 heme-binding domain and exists in two isoforms produced by alternative splicing: Isoform 1 is a single-pass membrane protein, while Isoform 2 is located in the cytoplasm .

Properties and Characteristics of Recombinant Human Cytochrome b5 (CYB5A)

Recombinant Human Cytochrome b5 (CYB5A) is typically produced in Escherichia coli (E. coli) as an expression host. The protein has a calculated molecular weight of approximately 17.5 kDa and an observed molecular weight of about 17 kDa. It is often tagged with an N-His tag for purification purposes. The purity of the recombinant protein is generally greater than 90%, as determined by reducing SDS-PAGE, and it contains less than 1.0 EU per μg of endotoxin .

Biological Functions and Research Findings

Cytochrome b5 (CYB5A) is known to enhance the activity of certain cytochrome P450 enzymes, such as CYP1A2, CYP2A6, and CYP2E1, by facilitating electron transfer during the catalytic cycle . Studies have shown that CYB5A can modulate the bioactivation activities of these enzymes, which are crucial for metabolizing drugs and environmental toxins .

Impact on CYP Enzymes

  • CYP1A2: CYB5A has been shown to significantly impact the activity of CYP1A2, particularly in human liver microsomes (HLM), where it correlates with the enzyme's kinetic parameters .

  • CYP2A6 and CYP2E1: Similar stimulatory effects have been observed for these enzymes, highlighting CYB5A's role in enhancing their bioactivation activities .

Applications and Uses

Recombinant Human Cytochrome b5 (CYB5A) is used in various research applications, including:

  • Drug Metabolism Studies: To understand how drugs are metabolized by the cytochrome P450 system.

  • Toxicity Testing: In assessing the bioactivation of promutagens by CYP enzymes.

  • Biotechnology: As a tool in biotechnological applications involving membrane-bound oxygenases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
CYB5A; CYB5; Cytochrome b5; Microsomal cytochrome b5 type A; MCB5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-134
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
CYB5A
Target Protein Sequence
AEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAV AVALMYRLYMAED
Uniprot No.

Target Background

Function
Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for various membrane-bound oxygenases.
Gene References Into Functions

Cytochrome b5 Function: Relevant Research

  1. A homodimer model resolves the competition between cytochrome P450 oxidoreductase and cytochrome b5 for the same cytochrome P450c17 binding site. (Review) PMID: 28000554
  2. CYP17A1 (with NADPH-P450 reductase) exhibits distributive enzymatic activity, although some processivity is observed; CYB5A does not enhance the reaction by altering ligand k(off) for CYP17A1. PMID: 28684414
  3. Cytochrome b5 (CYB5) and cytochrome b5 reductase 3 (CYB5R3) reduce human cytoglobin (CYGB) significantly faster than known physiological substrates; these three proteins appear to form a metabolon involved in nitric oxide generation. PMID: 28671819
  4. While Mn-b5 binds to CYP17A1, it does not enhance the lyase reaction, indicating a redox effector role for cyt b5 in the CYP17A1-mediated lyase reaction crucial for androgen synthesis. PMID: 27297105
  5. This study presents a model of the full-length human P450 1A2-cyt b5 complex, assembled using a multiscale modeling approach incorporating all-atom and coarse-grained molecular dynamics (MD). PMID: 26918755
  6. Cytochrome b5 influences the electronic conductivity of cytochrome P450c17 through allosteric protein-protein interactions. PMID: 26587646
  7. CYB5A and CYB5R3 variants should be considered when assessing breast cancer risk in African American women. PMID: 25225034
  8. CYB5A is the first RA susceptibility gene identified in androgen synthesis; SNP rs1790834 contributes to the sex bias in RA. PMID: 25890314
  9. The area and ratio of 3betaHSD and CYB5A double-positive cells correlate with adrenal development and influence age-related serum androstenedione levels. PMID: 24832628
  10. Glu-48 and Glu-49 of cytochrome b5 are essential for stimulating the 17,20-lyase activity of CYP17A1. PMID: 25315771
  11. Inhibition of CYB5A-deregulated downstream pathways (e.g., those involving TRAF6) may promote autophagy-mediated cancer cell death in specific patient subgroups. PMID: 24448000
  12. CYB5A (involved in stearyl-CoA-desaturase activity) and RNF10 are associated with adiposity and increased T2D risk in American Indians. PMID: 24151200
  13. Cytochrome b5 plays a key role in forming lipid-radical cycles in membranes. PMID: 24319746
  14. CYB5A is a novel prognostic factor for PDAC, exhibiting a tumor-suppressor function through autophagy induction and TRAF6 modulation. PMID: 24301457
  15. The CYP17A1/b5 interaction is stronger with pregnenolone (hydroxylase substrate) than with 17alpha-hydroxypregnenolone (lyase substrate) in the CYP17A1 active site. PMID: 23620596
  16. A human CYB5A missense mutation causes isolated 17,20 lyase deficiency in individuals with 46,XY disorder of sex development. PMID: 22170710
  17. Human adrenal cells expressing 3beta-hydroxysteroid dehydrogenase type 2 (HSD3B2) and cytochrome b5 (CYB5A) contribute to adrenal androstenedione production. PMID: 21185375
  18. Cygb functions as a nitric-oxide dioxygenase, with ascorbate and cytochrome b(5) acting as reductants. PMID: 20511233
  19. 17,20-lyase deficiency is demonstrated due to an aberrant CytB5. PMID: 20080843
  20. Novel cSNPs alter protein expression and/or hydroxylamine reduction activities, but minimally impact phenotypic variability. PMID: 19997042
  21. Mitochondrial and microsomal cytochromes b(5) exhibit distinct structural and biophysical characteristics. PMID: 14733950
  22. CytB5 colocalization with P450c17 supports its role in regulating the androgen biosynthetic pathway. PMID: 14985252
  23. Cytochrome b5 and phosphorylation enhance 17,20 lyase activity independently, likely by increasing the P450c17 and NADPH-cytochrome P450 oxidoreductase interaction. PMID: 15687493
  24. Cytochrome b(5) gene transcription is regulated by Sp3, GATA-6, and steroidogenic factor 1 in human adrenal NCI-H295A cells. PMID: 15831526
  25. A CYP2E1-b(5) complex model provides insights into protein interaction. PMID: 16679316
  26. Cytochrome b(5) plays a role in hydroxyl radical generation. PMID: 17320757
  27. Cytochrome b5 alters multiple catalytic cycle steps through interactions with CYP2C9 and P450 reductase. PMID: 17446262
  28. The T60A cyt b5 variant shows altered hydroxylamine substrate affinity and reduced cyt b5 expression. PMID: 17622936
  29. Recombinant fused enzymes CYP3A4-truncated (t)-P450 reductase-t-b5 (3RB) and CYP3A4-t-b5-t-P450 reductase (3BR) exhibit higher 6beta-hydroxylation of testosterone activity than reconstitution premixes. PMID: 17691855
  30. Cytochrome b5, rather than O(2)(*-) plays a major role in IDO activation in human cells. PMID: 18299324
Database Links

HGNC: 2570

OMIM: 250790

KEGG: hsa:1528

STRING: 9606.ENSP00000341625

UniGene: Hs.465413

Involvement In Disease
Methemoglobinemia CYB5A-related (METHB-CYB5A)
Protein Families
Cytochrome b5 family
Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.; [Isoform 2]: Cytoplasm.

Q&A

What is human Cytochrome b5 (CYB5A) and what are its main biological functions?

Human Cytochrome b5 (CYB5A) is a membrane-bound hemoprotein that functions as an electron carrier for several membrane-bound oxygenases . This well-conserved protein plays pivotal roles in multiple cellular metabolic processes, particularly in:

The protein contains a heme group coordinated by two histidine residues that are absolutely conserved across species, which is essential for its electron transport capabilities . These histidine residues reside in the loops between helices α2-α3 and α4-α5, providing the structural framework necessary for binding the heme cofactor in functional CYB5A proteins .

What is the structural organization of human CYB5A?

Human CYB5A exhibits a characteristic structural organization consisting of:

  • A cytochrome b5 heme-binding domain with a specific secondary structure arrangement (β1-α1-β4-β3-α2-α3-β5-α4-α5-β2-α6)

  • Two histidine residues that are absolutely conserved and critical for heme binding

  • Either a transmembrane domain or a soluble form, depending on the isoform

The microsomal form (isoform 1) contains a C-terminal transmembrane domain of approximately 16-18 amino acids that anchors the protein to the endoplasmic reticulum membrane . This arrangement is consistent across eukaryotic microsomal CYB5A proteins. The full-length human CYB5A consists of 134 amino acids, with the functional domain residing in the first 108 amino acids in recombinant proteins typically used for research .

How do the isoforms of human CYB5A differ in their cellular localization and function?

Human CYB5A exists in two primary isoforms produced by alternative splicing, which differ significantly in their cellular localization and, consequently, their functions:

  • Isoform 1: A single-pass membrane protein anchored to the endoplasmic reticulum via a C-terminal transmembrane domain. This isoform participates in lipid metabolism, cytochrome P450-mediated reactions, and other ER-associated metabolic processes .

  • Isoform 2: Located in the cytoplasm as a soluble protein, lacking the transmembrane anchor. This isoform likely participates in cytosolic electron transfer reactions .

These differences in localization allow CYB5A to contribute to distinct cellular processes in multiple subcellular compartments. The membrane-bound form primarily supports endoplasmic reticulum-associated metabolic functions, while the soluble form facilitates cytosolic electron transfer activities.

What expression systems are most effective for producing recombinant human CYB5A?

Multiple expression systems have been successfully used to produce recombinant human CYB5A, each with distinct advantages:

Expression SystemAdvantagesConsiderationsApplication
E. coliHigh yield, cost-effective, rapid expressionLacks post-translational modifications, potential endotoxin contaminationStructural studies, antibody production
Baculovirus-infected insect cellsProper folding, post-translational modifications, lower endotoxin levelsHigher cost, longer production timeFunctional studies, protein-protein interaction analyses

For E. coli-based expression, the protein is typically produced with a His-tag for easy purification, resulting in a calculated molecular weight of approximately 17.5 kDa with an observed molecular weight of 17 kDa on SDS-PAGE . Baculovirus expression systems can produce the protein in the 1-108 amino acid range with >90% purity and endotoxin levels <1 EU/μg .

When selecting an expression system, researchers should consider the intended application, required post-translational modifications, and whether the transmembrane domain should be included or excluded.

What purification strategies yield the highest purity recombinant CYB5A?

Effective purification of recombinant human CYB5A typically involves:

  • Affinity chromatography: His-tagged CYB5A can be purified using nickel or cobalt affinity columns, with elution typically performed using imidazole gradients.

  • Size exclusion chromatography: A secondary purification step to separate aggregates and achieve >90% purity.

  • Buffer optimization: Most commercial preparations use phosphate buffers (20mM PB, 150mM NaCl, 0.1mM EDTA, pH 7.25) to maintain stability .

  • Protectants for lyophilization: When preparing lyophilized protein, adding 5-8% trehalose, mannitol, and 0.01% Tween 80 helps maintain protein integrity and facilitates reconstitution .

The resulting purified protein should be validated using SDS-PAGE to confirm purity (typically >90%) and spectral analysis to verify the presence of the heme group, which gives cytochrome b5 its characteristic absorption spectrum .

How do genetic variants in CYB5A affect metabolic phenotypes in different populations?

Genetic variants in CYB5A have been associated with significant metabolic phenotypes, particularly in specific ethnic populations:

Research on Southwest American Indian (SWAI) populations has identified functional variants in CYB5A that are enriched in this specific population and associate with body mass index (BMI) and energy expenditure . Specifically:

  • The variant rs548402150, when combined with two splicing quantitative trait loci (QTLs) in CYB5A, forms a haplotype that is carried almost exclusively by SWAI individuals.

  • This haplotype associates with higher BMI and decreased CYB5A expression.

  • Conversely, the most common haplotype found across all ethnic groups associates with lower BMI, decreased body fat percentage, increased 24-hour energy expenditure, and increased CYB5A expression .

These findings suggest that CYB5A plays a role in regulating energy expenditure and may contribute to obesity risk, with population-specific variants potentially explaining some of the differential susceptibility to obesity across ethnic groups.

What role does CYB5A play in hereditary diseases?

Defects in the CYB5A gene can result in type IV hereditary methemoglobinemia, a rare disorder characterized by an abnormal form of hemoglobin that cannot effectively carry oxygen . This condition results from impaired electron transfer capabilities of the defective CYB5A protein.

Type IV hereditary methemoglobinemia manifests with:

  • Cyanosis (bluish discoloration of the skin)

  • Fatigue and weakness

  • Potential developmental delays in severe cases

Understanding the molecular mechanisms through which CYB5A mutations lead to methemoglobinemia provides insights into both the normal function of this protein in erythrocytes and potential therapeutic approaches for affected individuals.

How does CYB5A contribute to cancer progression and metastasis?

Recent research has uncovered significant roles for CYB5A in cancer biology, particularly in hepatocellular carcinoma (HCC):

CYB5A has been identified as playing a key role in HCC metastasis by inhibiting the JAK1/STAT3 pathway through binding to STOML2 (Stomatin-like protein 2) . This interaction has several important implications:

These findings suggest that CYB5A status could potentially serve as a biomarker for HCC progression and that targeting the CYB5A-STOML2-JAK1/STAT3 axis might represent a therapeutic approach. Notably, research has shown that application of the JAK1 inhibitor Ruxolitinib in metastatic tumors with high CYB5A expression slowed disease progression and prolonged survival in mouse models .

What methodologies are most effective for studying CYB5A protein-protein interactions?

Investigating CYB5A protein-protein interactions requires sophisticated methodological approaches:

  • Co-immunoprecipitation (Co-IP): Effective for identifying direct protein binding partners of CYB5A, as demonstrated in studies of CYB5A-STOML2 interaction in HCC .

  • Spectroscopic methods: The heme group in CYB5A provides unique spectral properties that can be leveraged to study binding interactions. The oxidized absorbance spectrum of purified recombinant cytochrome b5 can be analyzed to confirm structural integrity and interaction capabilities .

  • Homology modeling and structural analysis:

    • Homology modeling using established protein structures (such as rat, housefly, and Ostreococcus virus cytochrome b5 structures) can predict interaction interfaces.

    • Software tools like Modeller (v9.16) can generate independent models, with selection based on DOPE-HR (high resolution discrete optimized potential energy) scores .

    • Visualization tools like Pymol and structural analysis using programs like Thesesus provide further insights into interaction domains .

  • Subcellular colocalization prediction: Algorithms such as DeepLoc 1.0 and 2.0 can predict the subcellular compartments where CYB5A and potential interaction partners might colocalize, providing preliminary evidence for possible interactions .

  • Transcriptomic analysis coupled with protein characterization: This approach provides insights into when CYB5A is expressed during biological processes (such as viral replication cycles) and which potential binding partners are co-expressed .

What are the current challenges in designing experiments with recombinant CYB5A?

Researchers working with recombinant human CYB5A face several experimental challenges:

  • Maintaining structural integrity: The heme-binding domain of CYB5A requires proper folding and heme incorporation for function. Experimental conditions must preserve these structural features, particularly when studying electron transfer capabilities.

  • Membrane association considerations: When studying the membrane-bound isoform, researchers must decide whether to include the transmembrane domain, which affects solubility but may be crucial for certain functions and interactions.

  • Expression system selection: Different research questions may require different expression systems:

    • E. coli-expressed protein (calculated MW: 17.5 kDa) is suitable for structural studies

    • Baculovirus-infected insect cell expression (aa range 1-108) may better preserve functionality for interaction studies

  • Storage and stability: Lyophilized proteins are generally stable for up to 12 months when stored at -20 to -80°C, while reconstituted protein solutions can be stored at 4-8°C for only 2-7 days. Aliquots of reconstituted samples remain stable at < -20°C for approximately 3 months .

  • Validation of activity: Unlike many enzymatic proteins, direct activity assays for CYB5A are challenging, as its primary function is electron transfer. Spectroscopic analysis of the heme group and functional assays measuring electron transfer to partner proteins are necessary to confirm biological activity.

How might CYB5A serve as a therapeutic target for metabolic and cancer treatments?

Based on recent findings, CYB5A presents several promising avenues for therapeutic development:

  • JAK1/STAT3 pathway modulation in cancer: The discovery that CYB5A inhibits the JAK1/STAT3 pathway through binding to STOML2 in HCC suggests potential for targeted therapies. Research has demonstrated that JAK1 inhibitor Ruxolitinib showed enhanced efficacy in metastatic tumors with high CYB5A expression, slowing disease progression and prolonging survival in mouse models . This represents the first report of Ruxolitinib's effect on the metastatic ability of HCC cells both in vivo and in vitro.

  • Metabolic disorder interventions: The association between CYB5A variants and BMI, body fat percentage, and 24-hour energy expenditure suggests that modulation of CYB5A activity might influence metabolic parameters . Understanding how CYB5A affects 24-hour energy expenditure could provide insights into obesity-related physiology and potentially identify novel targets for treating metabolic disorders.

  • Biomarker development: The correlation between CYB5A expression levels and clinical outcomes in HCC patients suggests potential utility as a prognostic biomarker . Further research may establish whether CYB5A expression, potentially in combination with other markers, could guide treatment decisions or risk stratification.

  • Lipid metabolism targeting: Given CYB5A's roles in fatty acid elongation, desaturation, and cholesterol biosynthesis, targeted modulation might affect cellular lipid composition . This could have applications in conditions characterized by dyslipidemia or altered membrane composition.

Future research will need to address how to specifically target CYB5A in relevant tissues while avoiding disruption of its essential physiological functions in other contexts.

What emerging technologies might advance our understanding of CYB5A biology?

Several cutting-edge technologies show promise for expanding our understanding of CYB5A:

  • Cryo-electron microscopy (cryo-EM): This technique could provide high-resolution structural insights into CYB5A membrane integration and interaction with partner proteins in near-native environments.

  • Advanced protein modeling: Building on existing homology modeling approaches, advanced computational tools incorporating machine learning (such as AlphaFold) could better predict CYB5A structure-function relationships and interaction dynamics .

  • Single-cell transcriptomics and proteomics: These approaches could reveal cell-specific expression patterns and functions of CYB5A across different tissues and disease states, providing context-specific understanding of its roles.

  • CRISPR-based genetic manipulation: Precise genome editing technologies enable creation of cellular and animal models with specific CYB5A variants or controlled expression levels, facilitating mechanistic studies of its diverse functions.

  • Metabolomics integration: Combining CYB5A functional studies with comprehensive metabolomics could illuminate how this protein influences specific metabolic pathways across different physiological and pathological conditions.

These technologies, individually and in combination, promise to advance our understanding of both the fundamental biology of CYB5A and its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.