Recombinant Human Cytochrome c oxidase protein 20 homolog (COX20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
COX20; FAM36A; Cytochrome c oxidase assembly protein COX20, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
COX20
Target Protein Sequence
MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCD VGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
Uniprot No.

Target Background

Function
COX20 is essential for the assembly of mitochondrial respiratory complex IV (CIV), also known as cytochrome c oxidase. It functions as a chaperone in the early stages of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation. Specifically, COX20 stabilizes the nascent protein and facilitates its interaction with metallochaperones SCO1/2, enabling the incorporation of mature MT-CO2/COX2 into the assembling CIV holoenzyme.
Gene References Into Functions
  1. COX20 collaborates with SCO1 and SCO2 in COX2 maturation and cytochrome c oxidase assembly. PMID: 24403053
  2. Studies have linked COX20 mutations to a recessively inherited, early-onset dystonia-ataxia syndrome, characterized by reduced complex IV activity. PMID: 24202787
  3. Research elucidates the role of the human gene FAM36A/COX20 in complex IV assembly and its involvement in complex IV deficiency. PMID: 23125284
  4. Findings suggest that HNRNPU, FAM36A, and NCRNA00201 are not primary genes for microcephaly and corpus callosum abnormalities but are potential candidates for intellectual disability (ID) and seizures. PMID: 22678713
Database Links

HGNC: 26970

OMIM: 220110

KEGG: hsa:116228

STRING: 9606.ENSP00000406327

UniGene: Hs.411490

Protein Families
COX20 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.