Recombinant Human Cytochrome P450 4F12 (CYP4F12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
CYP4F12; UNQ568/PRO1129; Cytochrome P450 4F12; CYPIVF12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CYP4F12
Target Protein Sequence
MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF WGHLGLITPTEEGLKNSTQMSATYSQGFTIWLGPIIPFIVLCHPDTIRSITNASAAIAPK DNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQH LASEGSSCLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHIL QHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE LLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKV VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ
Uniprot No.

Target Background

Function

Recombinant Human Cytochrome P450 4F12 (CYP4F12) is a monooxygenase enzyme involved in the metabolism of endogenous polyunsaturated fatty acids (PUFAs). Its mechanism involves molecular oxygen, incorporating one oxygen atom into a substrate while reducing the second to water. This process utilizes two electrons provided by NADPH via cytochrome P450 reductase (CPR). CYP4F12 catalyzes the hydroxylation of carbon-hydrogen bonds, preferentially at the omega-2 position. It metabolizes (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) to 18-hydroxyarachidonate and catalyzes the epoxidation of PUFAs like docosapentaenoic and docosahexaenoic acids. While exhibiting low omega-hydroxylase activity towards leukotriene B4 and arachidonate, CYP4F12 plays a significant role in xenobiotic metabolism and catalyzes the hydroxylation of the antihistamine ebastine.

Gene References Into Functions
  1. Studies indicate that human and marmoset P450 3A4/90 and 4F12 in livers or small intestines are crucial in terfenadine t-butyl hydroxylation. Marmosets may serve as a suitable model for studying the first-pass extraction of terfenadine and related substrates in humans. PMID: 28436281
  2. Research demonstrates that HCV infection upregulates CYP4F12 protein expression, which interacts with the HCV replication complex, facilitating viral replication. PMID: 26845356
  3. CYP4F8 and CYP4F12 catalyze the epoxidation of 22:6n-3 and 22:5n-3, with CYP4F8 also exhibiting omega-3 hydroxylation of 22:5n-6. PMID: 16112640
Database Links

HGNC: 18857

OMIM: 611485

KEGG: hsa:66002

STRING: 9606.ENSP00000321821

UniGene: Hs.131459

Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane. Microsome membrane.
Tissue Specificity
Expressed in small intestine, liver, colon and heart.

Q&A

What is the primary function of CYP4F12 in human metabolism?

Cytochrome P450 4F12 is a member of the cytochrome P450 superfamily that functions as a monooxygenase. It catalyzes numerous reactions involved in drug metabolism and synthesis of cholesterol, steroids, and other lipids . CYP4F12 is primarily expressed in the liver and throughout the gastrointestinal tract, suggesting a significant role in first-pass metabolism of xenobiotics . Methodologically, researchers can study CYP4F12 function through recombinant protein expression systems, particularly in yeast models which have shown the enzyme's capacity to oxidize arachidonic acid by adding hydroxyl residues to carbons 18 or 19, forming 18-hydroxyeicosatetraenoic acid (18-HETE) or 19-HETE . When investigating CYP4F12 function, researchers should employ multiple experimental approaches including enzyme activity assays, substrate specificity tests, and inhibition studies to comprehensively characterize its metabolic profile.

How does the structure of CYP4F12 relate to other members of the CYP4F gene cluster?

CYP4F12 is part of a cluster of cytochrome P450 genes located on chromosome 19, which includes CYP4F2 and CYP4F11 . The protein sequences of CYP4F2, CYP4F11, and CYP4F12 share 81-93% similarity, making them structurally homologous . This high sequence similarity creates challenges in developing specific antibodies for protein detection due to cross-reactivity issues . The full-length human CYP4F12 protein consists of 524 amino acids . For structural analysis, researchers should consider computational approaches such as homology modeling, as crystal structures may not be available. Additionally, gene editing technologies could be employed to evaluate the specific functions of these CYP4F genes and distinguish them from their homologs .

What are the optimal methods for detecting CYP4F12 expression in tissue samples?

For improved specificity, researchers can utilize:

  • RNA sequencing to quantify transcript abundance

  • Targeted proteomics approaches such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

  • Gene editing techniques to create specific knockout models for functional validation

Expression analysis should include appropriate housekeeping genes for normalization and statistical methods to account for individual variability. In a study analyzing 149 human liver samples, researchers successfully quantified CYP4F12 mRNA expression and correlated it with genetic polymorphisms using these approaches .

How does CYP4F12 expression vary across different cell lines relevant to cancer research?

CYP4F12 expression demonstrates significant heterogeneity across head and neck squamous cell carcinoma (HNSC) cell lines, which is critical information for researchers designing in vitro studies. Based on RNA-SEQ data from the CCLE database, CYP4F12 shows highest abundance in cell lines including BICR22, PE/CA-PJ15, SNU-1066, and CAL-33 . In contrast, expression is almost negligible in cell lines such as HSC-3, YD-15, PE/CA-PJ49, YD18, FaDu, PE/CA-PJ41, and SCC-9 .

This variation suggests that researchers should carefully select appropriate cell models for CYP4F12 studies based on expression profiles. When investigating the role of CYP4F12 in cancer progression, researchers should consider:

  • Validating expression levels in their specific cell lines before conducting experiments

  • Using cell lines with naturally high and low expression as comparative models

  • Employing overexpression and knockdown approaches to manipulate expression levels

Additionally, CYP4F12 expression is significantly downregulated in HNSC tumor tissues compared to adjacent non-tumor tissues, as confirmed through multiple datasets (TCGA, GSE107951, GSE58911) and validated in 22 pairs of clinical samples .

What are the primary substrates metabolized by CYP4F12 and the optimal conditions for in vitro enzyme activity assays?

CYP4F12 exhibits diverse substrate specificity that researchers should consider when designing enzyme activity assays. The primary substrates metabolized by CYP4F12 include:

  • Arachidonic acid - CYP4F12 hydroxylates arachidonic acid at positions 18 and 19 to form 18-HETE and 19-HETE

  • Antihistamine drugs - CYP4F12 metabolizes ebastine and terfenadine

  • Prostaglandins - It converts prostaglandin H2 (PGH2) and PGH1 to their corresponding 19-hydroxyl analogs

  • Omega-3 fatty acids - CYP4F12 exhibits epoxygenase activity on docosahexaenoic acid (DHA) and eicosapentaenoic acid (EPA), converting them to epoxydocosapentaenoic acids (EDPs) and epoxyeicosatetraenoic acids (EEQs)

  • Leukotriene B4 - CYP4F12 catalyzes leukotriene B4 omega-hydroxylation, though with lower activity than CYP4F2

For optimal in vitro enzyme activity assays, researchers should:

  • Express recombinant CYP4F12 in appropriate systems (E. coli, yeast, or insect cells)

  • Include necessary cofactors such as NADPH and cytochrome P450 reductase

  • Maintain optimal pH (typically 7.4) and temperature (37°C)

  • Use sensitive detection methods such as LC-MS/MS for metabolite identification

  • Include positive controls with known CYP4F12 substrates

  • Employ selective inhibitors to confirm the specificity of the reaction

How can researchers effectively distinguish between CYP4F12 activity and other closely related CYP4F enzymes in metabolic studies?

Distinguishing CYP4F12 activity from other closely related CYP4F enzymes represents a significant methodological challenge due to their high sequence similarity and overlapping substrate specificity. Researchers can implement several approaches to address this challenge:

  • Selective substrate approach: Identify and utilize substrates with higher selectivity for CYP4F12 over other CYP4F enzymes. For example, CYP4F12 metabolizes antihistamines like ebastine with greater specificity than other CYP4F enzymes .

  • Double-filtering strategy: As demonstrated by researchers developing isoenzyme-specific fluorescent probes, a two-stage approach can be effective :

    • First stage: Screen near-infrared (NIR) fluorophores with alkoxyl groups for CYP-activated fluorescent substrates

    • Second stage: Conduct reverse protein-ligand docking to determine isoenzyme specificity

  • Recombinant enzyme systems: Express individual CYP4F enzymes in isolation and compare their metabolic profiles under identical conditions.

  • Genetic manipulation: Utilize siRNA knockdown or CRISPR-Cas9 gene editing to selectively reduce expression of specific CYP4F enzymes in cellular systems.

  • Selective inhibitors: Employ chemical inhibitors with known selectivity profiles to differentially inhibit CYP4F enzymes.

  • Kinetic analysis: Compare enzyme kinetics (Km, Vmax) across different substrates to identify distinguishing characteristics between CYP4F isoforms.

When conducting inhibition studies, researchers should follow a systematic approach from initial screening to detailed characterization, progressing from reversible inhibition testing to mechanism-based inhibition determination, and finally to Ki value calculation rather than relying solely on IC50 values, as Ki is independent of substrate concentration .

How is CYP4F12 expression altered in head and neck squamous cell carcinoma, and what methodologies are best for studying its role as a biomarker?

CYP4F12 expression is significantly downregulated in head and neck squamous cell carcinoma (HNSC) compared to adjacent non-tumor tissues . This downregulation has been consistently demonstrated across multiple datasets:

  • The Cancer Genome Atlas (TCGA) dataset

  • Gene Expression Omnibus (GEO) datasets (GSE107951 and GSE58911)

  • Independent validation in 22 pairs of clinical HNSC samples and adjacent non-tumor tissues

Additionally, CYP4F12 expression is significantly higher in HNSC patients with HPV infection compared to those without .

For researchers investigating CYP4F12 as a biomarker in HNSC, the following methodological approaches are recommended:

  • Expression analysis methods:

    • qRT-PCR for mRNA quantification

    • RNAscope or in situ hybridization for spatial expression profiling

    • Immunohistochemistry with validated antibodies, acknowledging potential cross-reactivity limitations

  • Clinical correlation analysis:

    • Associate expression levels with clinicopathological features

    • Conduct survival analysis using Kaplan-Meier plots and Cox regression

    • Evaluate correlation with treatment response

  • Functional validation:

    • Overexpression and knockdown experiments in appropriate HNSC cell lines

    • Analysis of cell migration, adhesion, and EMT marker expression

    • In vivo studies using xenograft models

  • Comparative analysis:

    • Integrate with immune infiltration profiles

    • Correlate with other established biomarkers

    • Multi-omics integration (genomics, transcriptomics, proteomics)

These approaches have successfully demonstrated that CYP4F12 overexpression inhibits cell migration and enhances adhesion between cells and matrix by inhibiting the epithelial-mesenchymal transition (EMT) pathway in HNSC cells .

What is the relationship between CYP4F12 genetic variants and warfarin dose requirements, and how should researchers design studies to investigate this association?

The relationship between CYP4F12 genetic variants and warfarin dose requirements involves complex interactions within the CYP4F gene cluster. CYP4F12 is part of the highly polymorphic CYP4F gene cluster that exhibits a high degree of linkage disequilibrium, making it challenging to define causal variants that affect warfarin response . Studies investigating this relationship should consider several key factors:

Researchers should note that in some populations, the influence of CYP4F SNPs may be minimal due to competing effects of different SNPs within the gene cluster that may cancel out the effects on CYP4F2 mRNA expression and warfarin dosing requirements .

How can recombinant CYP4F12 be effectively produced and purified for structural and functional studies?

Production and purification of recombinant CYP4F12 for structural and functional studies requires careful optimization. Based on established methodologies, researchers should consider the following approach:

  • Expression system selection:

    • E. coli: Commonly used for full-length human CYP4F12 protein (1-524aa) with N-terminal His-tag

    • Yeast: Suitable for functional studies as demonstrated for CYP4F12's capacity to oxidize arachidonic acid

    • Insect cells (baculovirus): Often preferred for eukaryotic post-translational modifications

  • Construct design optimization:

    • N-terminal modification: Consider truncation or modification of the N-terminal hydrophobic region to improve solubility

    • Codon optimization: Essential for enhancing expression in heterologous systems

    • Fusion tags: His-tag is commonly used for purification; consider TEV protease cleavage site for tag removal

  • Expression conditions:

    • Induction parameters: Optimize temperature, inducer concentration, and duration

    • Heme supplementation: Add δ-aminolevulinic acid as a heme precursor

    • Chaperone co-expression: Consider co-expressing molecular chaperones to aid proper folding

  • Purification protocol:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Buffer optimization: Include glycerol (typically 20%) and stabilizing agents

  • Quality assessment:

    • Purity: >90% as determined by SDS-PAGE

    • Spectral characteristics: CO-difference spectrum to confirm proper heme incorporation

    • Functional validation: Substrate binding and activity assays

  • Storage considerations:

    • Lyophilization: Often supplied as lyophilized powder

    • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Reconstitution: In deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol

    • Storage temperature: -20°C/-80°C with aliquoting to avoid repeated freeze-thaw cycles

This methodological approach has been successfully employed to produce recombinant full-length human CYP4F12 protein with >90% purity as determined by SDS-PAGE .

What approaches should researchers use to develop isoform-selective inhibitors or probes for CYP4F12?

Developing isoform-selective inhibitors or probes for CYP4F12 presents a significant challenge due to the high sequence similarity among CYP4F family members. Researchers should implement a systematic, multi-faceted approach:

  • Double-filtering strategy for probe development:

    • First-stage filtering: Screen near-infrared (NIR) fluorophores with alkoxyl groups for CYP-activated fluorescent substrates using a CYPs-dependent incubation system

    • Second-stage filtering: Employ reverse protein-ligand docking between fluorescent substrates and human CYPs to determine isoenzyme specificity

    • Generate CYP isoform-catalytic selectivity spectra based on calculated catalytic distance and relative binding energy

  • Structure-based design:

    • Homology modeling of CYP4F12 based on crystallized CYP structures

    • Molecular docking studies to identify unique binding pockets

    • Fragment-based drug design targeting isoform-specific regions

    • Molecular dynamics simulations to understand dynamic binding interactions

  • High-throughput screening:

    • Establish a robust screening assay with recombinant CYP4F12

    • Screen chemical libraries for selective inhibitors

    • Include counter-screening against other CYP4F isoforms to assess selectivity

    • Validate hits using secondary assays and selectivity panels

  • Activity-based protein profiling:

    • Develop activity-based probes that become covalently attached to active CYP4F12

    • Design probes with reporter tags (fluorescent, biotin) for detection

    • Use click chemistry approaches for probe development

  • Validation methodologies:

    • In vitro enzyme inhibition studies with recombinant proteins

    • Cellular assays with overexpression/knockdown systems

    • Ex vivo studies with human tissue samples

    • In vivo validation in appropriate animal models

  • Specificity assessment:

    • Test against a panel of related CYP enzymes, particularly CYP4F2 and CYP4F11

    • Determine Ki values rather than IC50 for more reliable comparison

    • Progress from reversible inhibition testing to mechanism-based inhibition determination

This methodological framework has been successfully applied for developing isoform-selective probes for other CYP enzymes such as CYP2C9 and CYP2J2 , and can be adapted for CYP4F12-specific applications.

How can in vivo imaging techniques be optimized for studying CYP4F12 expression and activity in tumor models?

Optimizing in vivo imaging techniques for studying CYP4F12 expression and activity in tumor models requires a specialized approach that balances sensitivity, specificity, and physiological relevance. Based on existing methodologies, researchers should consider the following framework:

  • Probe development and validation:

    • Utilize the double-filtering strategy to identify CYP4F12-selective near-infrared (NIR) fluorescent probes

    • Synthesize probes with appropriate characteristics:

      • Excitation/emission in NIR range (650-900 nm) for better tissue penetration

      • High quantum yield in aqueous environments

      • Low toxicity and favorable pharmacokinetics

    • Validate probe specificity against recombinant CYP4F12 and related isoforms

  • Tumor model selection:

    • Choose cell lines with documented CYP4F12 expression profiles (e.g., BICR22, PE/CA-PJ15, SNU-1066, and CAL-33 for high expression; HSC-3, YD-15 for low expression)

    • Establish subcutaneous xenograft models in nude mice as demonstrated for HeLa and HepG2 cells

    • Consider orthotopic models for more physiologically relevant tumor microenvironments

  • Imaging protocol optimization:

    • Probe administration: Inject directly into solid tumors (50 μmol/L concentration has been effective)

    • Timing: Conduct imaging at multiple timepoints (0-60 minutes post-injection) to capture optimal signal-to-background ratio

    • Equipment: Utilize an in vivo imaging system with appropriate excitation (e.g., 630 nm) and emission (670-730 nm) filters

    • Multi-spectral imaging: Collect data across multiple wavelengths to distinguish specific signal from autofluorescence

  • Controls and validation:

    • Positive controls: Include tumors known to express CYP4F12

    • Negative controls: Use CYP4F12-negative tumors or pre-treatment with selective inhibitors

    • Ex vivo validation: Confirm imaging results with tissue analysis (IHC, qPCR)

    • Correlation analysis: Associate imaging signals with tumor characteristics and treatment responses

  • Quantitative analysis:

    • Develop standardized methods for signal quantification

    • Account for tissue absorption and scattering

    • Implement kinetic modeling to extract enzymatic parameters

This approach has been successfully applied for in vivo imaging of other CYP enzymes and can be adapted specifically for CYP4F12 in tumor models, following ethical guidelines for animal experimentation (e.g., as approved by the ethics committee of Dalian Medical University, AEE19047) .

What bioinformatic approaches are most effective for analyzing CYP4F12 expression patterns across different cancer types?

For comprehensive analysis of CYP4F12 expression patterns across cancer types, researchers should employ a multi-layered bioinformatic approach utilizing established databases and analytical tools:

  • Multi-cancer expression analysis:

    • The TIMER database has revealed that CYP4F12 mRNA expression is lower in multiple tumor tissues compared to matched normal tissues, including breast invasive carcinoma (BRCA), cholangiocarcinoma (CHOL), colon adenocarcinoma (COAD), head and neck squamous cell carcinoma (HNSC), kidney chromophobe (KICH), kidney renal papillary cell carcinoma (KIRP), liver hepatocellular carcinoma (LIHC), lung adenocarcinoma (LUAD), prostate adenocarcinoma (PRAD), thyroid carcinoma (THCA), and uterine corpus endometrial carcinoma (UCEC) .

  • Database integration and validation:

    • Primary data sources:

      • The Cancer Genome Atlas (TCGA): 543 HNSC cases have been analyzed for CYP4F12 expression

      • Gene Expression Omnibus (GEO): Datasets GSE107591 (23 normal and 24 tumor tissues) and GSE58911 (15 paired normal and tumor samples)

      • Cancer Cell Line Encyclopedia (CCLE): For cell line expression profiling

    • Analysis tools:

      • GEO2R online program for GEO dataset analysis

      • Ualcan database (http://ualcan.path.uab.edu/) for correlation with clinicopathologic variables

  • Statistical and visualization methods:

    • Differential expression analysis: Compare tumor vs. normal tissue using appropriate statistical tests

    • Correlation analysis: Associate expression with clinical parameters

    • Survival analysis: Kaplan-Meier plots and Cox regression

    • Heatmaps and clustering: Visualize expression patterns across cancer types

    • Volcano plots: Highlight significance and fold changes

  • Integrative approaches:

    • Pathway analysis: Connect CYP4F12 to related biological processes

    • Gene set enrichment analysis (GSEA): Identify enriched pathways correlated with CYP4F12 expression

    • Protein-protein interaction networks: Map CYP4F12's functional associates

    • Multi-omics integration: Combine with mutation, methylation, and proteomic data

  • Validation strategies:

    • Cross-validation across multiple datasets

    • Experimental validation in representative cell lines and tissues

    • Meta-analysis to increase statistical power

This comprehensive bioinformatic framework has successfully identified CYP4F12 as significantly downregulated in HNSC compared to adjacent non-tumor tissues, with validation across multiple independent datasets . Interestingly, CYP4F12 expression was found to be significantly higher in HNSC patients with HPV infection compared to those without, demonstrating the value of stratified analysis .

What are the critical quality control parameters for ensuring the functionality of recombinant CYP4F12 in enzymatic assays?

Ensuring the functionality of recombinant CYP4F12 in enzymatic assays requires rigorous quality control measures across multiple parameters:

  • Spectral characteristics assessment:

    • CO-difference spectrum analysis: The P450 reduced-CO complex should show characteristic absorption at 450 nm, with minimal P420 formation (indicative of denatured protein)

    • Absolute spectrum: Evaluate the Soret band position and intensity for proper heme incorporation

    • Substrate binding spectrum: Confirm Type I spectral shifts upon addition of known substrates

  • Protein integrity verification:

    • SDS-PAGE analysis: Confirm >90% purity with appropriate molecular weight (58-60 kDa)

    • Western blotting: Verify protein identity using specific antibodies (acknowledging potential cross-reactivity)

    • Mass spectrometry: Peptide mapping to confirm sequence integrity

    • Aggregation analysis: Size exclusion chromatography or dynamic light scattering

  • Enzymatic activity validation:

    • Substrate turnover rates: Measure activity with known substrates (arachidonic acid, ebastine, terfenadine)

    • Product formation: Quantify expected metabolites (18-HETE, 19-HETE) using LC-MS/MS

    • Enzyme kinetics: Determine Km and Vmax parameters

    • Stability testing: Assess activity retention over time and after freeze-thaw cycles

  • System compatibility:

    • NADPH consumption: Monitor NADPH oxidation spectrophotometrically

    • Cytochrome P450 reductase coupling: Confirm efficient electron transfer

    • Uncoupling assessment: Measure H2O2 formation as an indicator of uncoupled electron transfer

  • Storage and handling validation:

    • Freeze-thaw stability: Limit cycles and document activity loss

    • Temperature sensitivity: Test activity after storage at different temperatures

    • Buffer optimization: Confirm stabilizing effects of additives (glycerol, trehalose)

    • Reconstitution efficiency: Verify complete solubilization of lyophilized protein

  • Inter-batch reproducibility:

    • Establish acceptance criteria for specific activity

    • Compare multiple production batches for consistent activity

    • Implement reference standards for comparative analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.