Recombinant Human Cytochrome P450 4F8 (CYP4F8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CYP4F8; Cytochrome P450 4F8; CYPIVF8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CYP4F8
Target Protein Sequence
MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWF LGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDK DIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQR LAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFF RYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFID VLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE LLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVC NINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKV VLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG
Uniprot No.

Target Background

Function

Recombinant Human Cytochrome P450 4F8 (CYP4F8) is a monooxygenase enzyme involved in the metabolism of endogenous polyunsaturated fatty acids (PUFAs) and their oxygenated derivatives (oxylipins). It utilizes molecular oxygen, incorporating one oxygen atom into a substrate while reducing the second to water. This process requires two electrons supplied by NADPH via cytochrome P450 reductase (CPR). CYP4F8 catalyzes the hydroxylation of carbon-hydrogen bonds, preferentially at the omega-1 and omega-2 positions. A primary function is the omega-2 hydroxylation of (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) to form (18R)-hydroxyeicosatetraenoic acid (18R-HETE). It also exhibits omega-1 hydroxylase activity toward prostaglandins (PG) H1, PGH2, and PGI2, and catalyzes the epoxidation of PUFAs double bonds, including those in docosahexaenoic and docosapentaenoic acids. Activity against PGD2, PGE1, PGE2, PGF2α, and leukotriene B4 is minimal.

Gene References Into Functions
  1. The PLA2G7, HPGD, EPHX2, and CYP4F8 genes exhibit high expression in prostate cancer. PMID: 21281786
  2. CYP4F8 expression analysis reveals high levels in the epithelial linings and epidermis of psoriatic lesions. PMID: 12464258
  3. PGH synthase-2, CYP4F8, and PGE synthase-1 are likely involved in the formation of 19-hydroxy-PGE compounds in seminal vesicles and vas deferens. PMID: 15789615
  4. CYP4F8 and CYP4F12 catalyze the epoxidation of 22:6n-3 and 22:5n-3, and CYP4F8 performs omega-3 hydroxylation of 22:5n-6. PMID: 16112640
Database Links

HGNC: 2648

OMIM: 611545

KEGG: hsa:11283

UniGene: Hs.268554

Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the epithelium of seminal vesicles, in renal cortex, in adult and fetal liver, in epidermis, in corneal epithelium, in sweat glands, hair follicles, epithelial linings of the ampulla of vas deferens and of the stomach and small intestine, as

Q&A

What is CYP4F8 and what are its primary functions in human physiology?

CYP4F8 (Cytochrome P450 Family 4 Subfamily F Member 8) is a protein encoded by the CYP4F8 gene in humans. It belongs to the cytochrome P450 superfamily of enzymes, which are monooxygenases that catalyze numerous reactions involved in drug metabolism and synthesis of cholesterol, steroids, and other lipids .

The primary functions of CYP4F8 include:

  • Acting as a 19-hydroxylase of the arachidonic acid metabolite, prostaglandin H2 (PGH2) and the Dihomo-γ-linolenic acid metabolite PGH1 in seminal vesicles

  • Hydroxylating arachidonic acid (20:4n-6) to (18R)-hydroxyarachidonate

  • Catalyzing omega-2 and omega-3-hydroxylation of PGH1 and PGH2

  • Epoxidation of docosahexaenoic acid (DHA) and other polyunsaturated fatty acids

  • Involvement in the metabolism of eicosanoids, which play roles in inflammation and signaling

Unlike some other CYP enzymes, CYP4F8 shows little activity against prostaglandin D2, PGE1, PGE2, PGF2alpha, and leukotriene B4 .

What is the tissue distribution pattern of CYP4F8 expression in humans?

CYP4F8 exhibits a distinct tissue-specific expression pattern that differs from many other cytochrome P450 enzymes, which are predominantly expressed in the liver. The expression profile includes:

Tissue/OrganRelative ExpressionNotes
Seminal vesiclesHighPrimary site of expression
KidneyModerateConfirmed expression
ProstateModerateConfirmed expression
EpidermisModerateUpregulated in psoriatic skin
Corneal epitheliumModerateConfirmed expression
RetinaLowmRNA has been found
LiverLow/MinimalUnlike many other CYP enzymes

This tissue distribution suggests specialized functions in reproductive and epithelial tissues, distinguishing it from liver-predominant CYP enzymes involved primarily in xenobiotic metabolism .

What genomic and structural characteristics define the CYP4F8 gene and protein?

The CYP4F8 gene and protein have several defining genomic and structural characteristics:

Genomic Context:

  • Located on chromosome 19p13.12

  • Part of a cluster of cytochrome P450 genes on chromosome 19

  • CYP4F3, another member of this family, is approximately 18 kb away

  • Contains 13 exons

  • Genomic sequence is defined as NC_000019.10 (15615218..15630639) in GRCh38.p14

Protein Structure:

  • Also known as CPF8 or CYPIVF8

  • The calculated molecular weight is approximately 60 kDa (precise calculation: 63.4 kDa)

  • Contains a heme-thiolate core, characteristic of all P450 enzymes

  • Localizes to the endoplasmic reticulum (type II P450)

  • Requires interaction with NADPH and P450 oxidoreductase (POR) for electron transfer and catalytic activity

For recombinant production, the expression region typically spans amino acids 38-520 , which represents the catalytically active portion of the enzyme.

How does CYP4F8 differ from other members of the CYP4 family?

CYP4F8 has several distinguishing characteristics compared to other CYP4 family members:

FeatureCYP4F8Other CYP4 Family Members
Tissue DistributionPrimarily urogenital tissues, epithelial surfaces CYP4A11: Liver, kidney
CYP4F2/F3: Liver, kidney, myeloid tissues
CYP4V2: Retina
CYP4X1: Brain, airways
Substrate SpecificitySpecialized in PGH1/2 internal oxidations CYP4A11: Terminal ω-hydroxylation of fatty acids
CYP4F2/F3: LTB4, fatty acids
CYP4V2: ω3 PUFA metabolism
RegioselectivityPrimarily adds hydroxyl groups at C-19 positionMost CYP4 members target terminal (ω) or near-terminal (ω-1) positions
RegulationNot regulated by PPARα (unlike CYP4A enzymes) CYP4A and some other CYP4 members are PPARα-regulated
Disease AssociationUpregulated in psoriatic skin CYP4V2: Associated with Bietti's crystalline dystrophy
CYP4F2: Associated with hypertension

The substrate specificity and regioselectivity of CYP4F8 suggest a more specialized role in prostaglandin metabolism rather than the general fatty acid oxidation performed by many other CYP4 enzymes .

What are the optimal conditions for expressing and purifying active recombinant CYP4F8, and how can activity be validated?

Expressing and purifying active recombinant CYP4F8 requires careful optimization of several parameters:

Expression Systems:

  • E. coli: Most commonly used system, generally yields higher activity levels and turnover numbers compared to insect cell systems. Patented E. coli expression systems are available for native or minimally modified P450s with excellent batch-to-batch consistency .

  • Bacterial Bactosomes: Provide excellent linearity over time, allowing longer incubations and generating better results. Available as Classic Bactosomes or standardized EasyCYPs .

  • Insect cells: Alternative expression system (Supersomes), though typically with lower activity than bacterial systems .

Critical Parameters for Active Enzyme:

  • Expression region should span amino acids 38-520 to maintain catalytic functionality

  • Co-expression or addition of reductase partners is essential (high, medium, or low reductase levels can be selected depending on the application)

  • Optional addition of cytochrome b5 can enhance activity for certain substrates

  • Purification should maintain the heme-thiolate coordination essential for activity

Validation of Activity:

  • Spectroscopic validation: CO-difference spectrum should show characteristic 450 nm Soret peak

  • Enzymatic activity: Monitor 19-hydroxylation of PGH2 or PGH1 as the primary activity marker

  • Alternative substrate validation: Test hydroxylation of arachidonic acid to (18R)-hydroxyarachidonate

  • Positive controls: Compare activity with commercially available standards

Storage and Stability:

  • For liquid preparations: Store in Tris/PBS-based buffer with 5-50% glycerol at -20°C/-80°C (shelf life ~6 months)

  • For lyophilized preparations: Store powder in Tris/PBS-based buffer with 6% Trehalose at -20°C/-80°C (shelf life ~12 months)

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

What methodological approaches can be used to study CYP4F8 polymorphisms and their impact on enzyme function?

Studying CYP4F8 polymorphisms and their functional impacts requires a multi-faceted approach:

Identification of Polymorphisms:

  • Genome-wide association studies (GWAS): Can identify CYP4F8 variants associated with specific phenotypes

  • Targeted sequencing: Focus on the CYP4F8 gene and regulatory regions

  • Database mining: Utilize resources like Chinese Millionome Database (CMDB) and Genome Aggregation Database (gnomAD) to identify both common and rare variants

  • Variant classification: Categorize as missense, intronic, synonymous, etc.

In the Chinese population, analysis of the CMDB revealed that out of 8,682 variants in CYP genes, 66.9% (5,808/8,682) were in introns and only 4.3% (377/8,682) were missense variants .

Functional Analysis Methods:

  • In vitro enzyme assays: Compare wild-type and variant proteins for:

    • Substrate binding affinity (Km)

    • Maximum reaction velocity (Vmax)

    • Regioselectivity of hydroxylation

    • Product profile analysis by LC-MS/MS

  • Recombinant expression systems:

    • Express variant proteins in E. coli or other systems

    • Compare protein stability and folding

    • Assess heme incorporation

    • Measure electron transfer efficiency

  • Cellular models:

    • Transfect cells with wild-type or variant CYP4F8

    • Measure impact on eicosanoid profiles

    • Assess protein localization and stability

    • Evaluate effects on cellular functions

  • Computational approaches:

    • Molecular modeling to predict structural impacts

    • Molecular dynamics simulations to assess dynamic effects

    • In silico prediction of substrate binding and catalysis

For variants of interest, validation across multiple methodologies is recommended to establish clear genotype-phenotype correlations .

How can researchers effectively design studies to investigate the role of CYP4F8 in inflammatory skin conditions like psoriasis?

Designing effective studies to investigate CYP4F8's role in psoriasis requires a comprehensive, multi-level approach:

1. Patient Cohort Selection and Biospecimen Collection:

  • Include both psoriatic lesional and non-lesional skin from the same patients

  • Match with healthy control skin samples

  • Consider stratification by psoriasis severity (PASI scores)

  • Collect blood for genetic analysis and serum for eicosanoid profiling

  • Obtain detailed clinical history, including treatment response data

2. Expression Analysis Methodology:

  • Transcriptomic approach: RNA-seq or qPCR to quantify CYP4F8 mRNA levels

  • Proteomic approach: Western blotting and immunohistochemistry using validated antibodies (e.g., 20011-1-AP)

  • Single-cell analysis: Determine cell-type specific expression within skin layers

  • Spatial transcriptomics: Map expression patterns across lesional boundaries

3. Functional Studies:

  • Ex vivo skin models: Explant cultures treated with CYP4F8 inhibitors or siRNA

  • 3D organotypic skin models: With modulated CYP4F8 expression

  • Keratinocyte cultures: Primary cells from patients vs. controls

  • Metabolomic profiling: LC-MS/MS analysis of eicosanoids and prostaglandins

4. Mechanistic Investigations:

  • CYP4F8 knockdown/overexpression: Using CRISPR-Cas9 or lentiviral systems

  • Selective enzyme inhibition: Development of specific CYP4F8 inhibitors

  • Substrate profiling: Identification of relevant eicosanoid pathways

  • Inflammation models: Effect of CYP4F8 modulation on cytokine production

5. Clinical Correlation Studies:

  • Correlate CYP4F8 expression/activity with clinical parameters

  • Analyze treatment response based on CYP4F8 genotype/expression

  • Investigate relationships between CYP4F8 activity and inflammatory biomarkers

  • Longitudinal studies tracking CYP4F8 during disease flares and remissions

6. Genetic Association Studies:

  • Genotype CYP4F8 SNPs in large psoriasis cohorts

  • Perform GWAS with focus on eicosanoid pathway genes

  • Consider rare variant analysis through sequencing

  • Evaluate expression quantitative trait loci (eQTLs) affecting CYP4F8

The integrated data from these approaches would provide comprehensive insights into the potential role of CYP4F8 in psoriatic pathophysiology .

What are the methodological challenges in studying CYP4F8's role in eicosanoid metabolism compared to other CYP enzymes?

Studying CYP4F8's role in eicosanoid metabolism presents several unique methodological challenges compared to other CYP enzymes:

1. Tissue-Specific Expression Challenges:

  • CYP4F8 is predominantly expressed in urogenital tissues and epithelial surfaces, not in liver like many drug-metabolizing CYPs

  • Obtaining appropriate human tissue samples is ethically and practically difficult

  • Primary cell cultures often lose CYP expression over time

  • Immortalized cell lines may not maintain physiological CYP4F8 regulation

2. Substrate Complexity and Specificity Issues:

  • CYP4F8 works with prostaglandin endoperoxides (PGH1/PGH2), which are unstable intermediates

  • PGH1/PGH2 have short half-lives and require specialized handling

  • Multiple competing enzymatic pathways exist for these substrates

  • Distinguishing CYP4F8 activity from other eicosanoid-metabolizing enzymes requires specific inhibitors or genetic models

3. Analytical Challenges:

  • Products of CYP4F8 activity (19-hydroxy-PGH compounds) are difficult to detect

  • Requires sensitive LC-MS/MS methods with appropriate standards

  • Multiple hydroxylated products may form (positions 18, 19, and others)

  • Metabolite stability concerns during sample processing

4. Functional Redundancy:

FeatureCYP4F8Other Eicosanoid-Metabolizing CYPs
Regioselectivity19-hydroxylation, some 18-hydroxylation CYP4F2/F3: primarily ω-hydroxylation
CYP2C8: epoxidation
CYP5A1: different specificity
Tissue OverlapSome tissues express multiple CYP4F enzymesFunctional compensation possible
Genetic CompensationKnockdown may trigger upregulation of other CYPsComplicates interpretation of data

5. Technological and Experimental Design Solutions:

  • Use of recombinant systems with controlled expression of individual CYPs

  • Development of highly specific antibodies for immunoprecipitation prior to activity assays

  • Application of selective chemical inhibitors when available

  • CRISPR-Cas9 mediated knockout models in relevant cell types

  • Stable isotope labeling to track metabolic flux

  • Advanced separation techniques coupled with high-resolution mass spectrometry

These challenges necessitate careful experimental design and often require combining multiple complementary approaches to achieve valid, interpretable results about CYP4F8's specific roles .

How can researchers resolve discrepancies in reported catalytic activities of CYP4F8 across different experimental systems?

Resolving discrepancies in reported CYP4F8 catalytic activities requires systematic analysis of experimental variables and standardization of methods:

1. Expression System Differences Analysis:

  • Bacterial vs. Insect vs. Mammalian: E. coli expressed recombinant enzymes (Bactosomes) exhibit greater activity levels and turnover numbers compared to CYPs expressed from insect cells (Supersomes)

  • Post-translational modifications: Mammalian systems provide appropriate modifications that may be absent in bacterial systems

  • Membrane environment: Reconstitution systems vary in lipid composition, affecting enzyme conformation and activity

  • Solution: Direct comparison studies using the same substrate across different expression platforms with proper controls

2. Enzyme Preparation Variables:

  • Reductase partner ratios: The ratio of CYP4F8 to cytochrome P450 oxidoreductase (POR) significantly impacts activity

  • Presence/absence of cytochrome b5: Can greatly enhance the activity of some reactions

  • Reconstitution methods: Detergent vs. lipid reconstitution affects enzyme conformation

  • Solution: Standardize and clearly report reductase:CYP4F8:b5 ratios and reconstitution methods

3. Assay Condition Standardization:

ParameterVariable RangeRecommended Standardization
pH7.0-7.67.4 for physiological relevance
Temperature25-37°C37°C for human enzymes
Buffer compositionVariousPotassium phosphate buffer with controlled ionic strength
Substrate concentration1-100 μMFull Km determination (typically 1-10x Km for activity comparisons)
Incubation time5-60 minEstablish linearity range for each system
NADPH regenerating systemVariableStandardized glucose-6-phosphate/G6PDH system

4. Data Analysis and Reporting Standards:

  • Always report both Vmax and Km, not just specific activity at a single substrate concentration

  • Include positive controls with established substrates (arachidonic acid, PGH2)

  • Calculate and report intrinsic clearance (Vmax/Km) for meaningful comparisons

  • Validate enzyme concentration through CO-difference spectroscopy rather than total protein

  • Report multiple reaction products and their ratios

5. Methodological Reconciliation Approaches:

  • Cross-laboratory validation: Exchange materials and protocols between labs reporting discrepancies

  • Reference standard development: Establish a "gold standard" CYP4F8 preparation with defined activity

  • Batch-to-batch variability: Account for through normalization to standard substrates

  • Authentic standards: Use identical product standards for quantification across labs

By systematically addressing these variables, researchers can better understand whether discrepancies reflect true biological variables or methodological differences, leading to more consistent and comparable results across studies .

What are the current knowledge gaps and future research directions for understanding CYP4F8's physiological and pathophysiological roles?

Several significant knowledge gaps exist in understanding CYP4F8, offering important directions for future research:

1. Physiological Role Uncertainties:

  • The definitive physiological function of CYP4F8 in most expressing tissues remains unclear

  • The role of CYP4F8-generated metabolites in normal tissue homeostasis is poorly defined

  • Regulatory mechanisms controlling tissue-specific CYP4F8 expression are not fully characterized

  • Potential non-catalytic functions of CYP4F8 have not been explored

2. Pathological Significance Gaps:

  • The functional significance of CYP4F8 upregulation in psoriasis needs mechanistic clarification

  • Potential roles in other inflammatory skin conditions remain unexplored

  • Connections between CYP4F8 variants and disease susceptibility are poorly understood

  • The enzyme's potential involvement in inflammatory conditions of other expressing tissues (kidney, retina) is understudied

3. Technological Limitations:

  • Lack of highly selective CYP4F8 inhibitors hampers functional studies

  • Absence of validated animal models (mouse Cyp4f8 differs from human CYP4F8)

  • Limited availability of specific antibodies for distinguishing CYP4F8 from other CYP4F family members

  • Challenges in monitoring CYP4F8 activity in vivo

4. Promising Future Research Directions:

Research AreaSpecific DirectionsPotential Impact
Genetic StudiesComprehensive analysis of CYP4F8 variants in diverse populationsBetter understanding of pharmacogenetic implications and disease associations
Structural BiologyCrystal structure determination of CYP4F8Rational design of selective inhibitors and understanding of substrate specificity
Systems BiologyIntegration of CYP4F8 into eicosanoid metabolic networksComprehensive understanding of compensatory mechanisms and pathway interactions
Translational ResearchDevelopment of CYP4F8 biomarkers for inflammatory conditionsPotential diagnostic applications and therapeutic targeting
CRISPR-Based ModelsGeneration of tissue-specific CYP4F8 knockout modelsDefinitive determination of physiological functions
Single-Cell AnalysisCharacterization of cell-specific CYP4F8 expression in complex tissuesUnderstanding of cellular microenvironment effects
Drug DiscoveryDevelopment of selective CYP4F8 modulatorsPotential therapeutic approaches for inflammatory conditions

5. Methodological Innovations Needed:

  • Development of selective activity-based probes for CYP4F8

  • Improved methods for in situ detection of enzyme activity

  • Better tools for distinguishing between closely related CYP4F enzymes

  • Advanced imaging techniques to visualize enzyme-metabolite interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.