Recombinant Human Cytochrome P450 4V2 (CYP4V2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CYP4V2; Cytochrome P450 4V2; Docosahexaenoic acid omega-hydroxylase CYP4V2; Long-chain fatty acid omega-monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLV GHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDK SSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH INQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLW LDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFL DLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELD DVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAV IIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI LSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER
Uniprot No.

Target Background

Function
Recombinant Human Cytochrome P450 4V2 (CYP4V2) is a cytochrome P450 monooxygenase crucial for fatty acid metabolism in the eye. It catalyzes the ω-hydroxylation of polyunsaturated fatty acids (PUFAs), including docosahexaenoate (DHA) and its precursor eicosapentaenoate (EPA), contributing to retinal PUFA homeostasis. CYP4V2 also ω-hydroxylates saturated fatty acids such as laurate, myristate, and palmitate, exhibiting the highest catalytic efficiency with myristate, followed by laurate and then palmitate (C14 > C12 > C16). Mechanistically, it utilizes molecular oxygen, incorporating one oxygen atom into the substrate and reducing the second to water. The required two electrons are provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Gene References Into Functions
  1. This study represents a significant effort to identify the genetic basis of Bietti crystalline dystrophy (BCD) in Spain, highlighting the necessity of CYP4V2 variant analysis for reliable BCD diagnosis. PMID: 29691984
  2. This report details a homozygous R400C mutation in CYP4V2, with protein modeling strongly suggesting enzyme dysfunction. Long-term clinical follow-up reveals insights into disease progression and potential anti-inflammatory modulation of severity. PMID: 28698241
  3. BCD patients with CYP4V2 mutations exhibited more severe macular choroid atrophy compared to EYS-related retinitis pigmentosa patients, suggesting differences in choroidal expression between CYP4V2 and EYS. PMID: 27658286
  4. This study confirmed that a novel homozygous CYP4V2 variant caused a choroideremia-like fundus appearance in a patient. PMID: 27348340
  5. Photoreceptor outer segment and apical retinal pigment epithelium abnormalities underlie the extensive retinal dysfunction in early-stage BCD. Intravitreal Bevacizumab proved effective in treating choroidal neovascularization in this context. PMID: 27028354
  6. CYP4V2 mRNA and protein expression levels were significantly reduced following treatment with the peroxisome proliferator-activated receptor gamma (PPARγ) antagonist GW9662. PMID: 28729181
  7. Genetic analysis identified nineteen missense, four nonsense, two deletion, two splice site, and one insertion-deletion mutations in BCD patients. The age of the c.802-8_810del17insGC mutation was estimated to be 1040-8200 generations in Chinese and 300-1100 generations in Japanese populations. PMID: 28051075
  8. Subfoveal choroidal thickness and outer choroidal vascular area were smaller in BCD patients with CYP4V2 mutations than in matched retinitis pigmentosa patients with EYS mutations or healthy controls. PMID: 28763560
  9. This study expands the spectrum of CYP4V2 mutations causing BCD in Chinese families, aiding in genetic diagnosis, counseling, and future gene therapy. PMID: 26971461
  10. Variants in CTNNA1 and CYP4V2 genes were associated with Leber Congenital Amaurosis. PMID: 28453600
  11. Genetic analysis revealed a homozygous c.802-8_810delinsGC mutation in CYP4V2. PMID: 26865810
  12. In BCD patients with CYP4V2 mutations, cone density persisted despite visual dysfunction, as assessed by adaptive optics scanning laser ophthalmoscopy (AO-SLO). PMID: 26521715
  13. Four novel mutations were identified, expanding the spectrum of CYP4V2 mutations associated with Bietti's crystalline dystrophy. PMID: 25593508
  14. The c.219T>A (p.F73L) mutation in CYP4V2 may be a recurrent mutation in Chinese patients with BCD. PMID: 24739949
  15. Likely disease-causing variants were identified in 34 chromosomes from 17 families. Seven were novel, including p.Met66Arg, found in all 11 patients from 8 families of South Asian descent. PMID: 24480711
  16. This suggests that lens crystals in BCD patients are formed similarly to corneal or retinal crystalline deposits, resulting from a systemic lipid metabolism abnormality. PMID: 23793346
  17. This study describes a Spanish family with BCD, exhibiting central and paracentral keratopathy, and details the molecular analysis of the causative gene. PMID: 23538635
  18. Sequencing of CYP4V2 revealed five mutations in a 29-year-old male with Bietti's crystalline dystrophy. PMID: 23242590
  19. Sequencing of CYP4V2 identified nine sequence variants in four unrelated families and six isolated individuals with BCD. PMID: 23221965
  20. Two mutations in CYP4V2 were identified in three Lebanese families with BCD: p.I111T (c.332T>C) in two families and the novel p.V458M (c.1372G>A) mutation in one family. PMID: 22605929
  21. Compound heterozygous c.802-8_810del17insGC and c.1091-2A>G mutations in CYP4V2 were identified as causative mutations for retinitis pigmentosa. PMID: 22693542
  22. This study identified the most sensitive functional methods for assessing BCD patients and the significance of the pupillary light reflex in advanced stages. PMID: 21892605
  23. Four novel benign variations in CYP4V2 (three in exons and one in an intron) were observed in BCD patients with choroidal neovascularization. PMID: 21850171
  24. These results provide a comprehensive overview of the CYP4V2 mutation spectrum and its frequency in families with BCD. PMID: 21565171
  25. Review: Genetic analyses have identified a wide spectrum of mutations in the CYP4V2 gene in patients with BCD, and mutations in the CYP4F22 gene have been linked to lamellar ichthyosis. PMID: 21540472
  26. This study describes a BCD patient with a CYP4V2 gene mutation and typical leukocyte inclusions, exhibiting classical retinal lesions but a normal electroretinogram. PMID: 21385027
  27. Crystal-like deposits can appear on the lens capsule in BCD patients with CYP4V2 gene mutations. PMID: 19508456
  28. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  29. Defective ω-oxidation of ocular fatty acids/lipids due to CYP4V2 mutations is a plausible mechanism underlying the abnormal lipid metabolism in BCD. PMID: 19661213
  30. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20205591
  31. BCD is caused by mutations in the CYP4V2 gene. PMID: 15042513
  32. The IVS6 to 8delTCATACAGGTCATCGCG/insGC mutation appears common in Japanese BCD patients. PMID: 15860296
  33. Homozygous and compound heterozygote deletion/insertion mutations and novel nonsense (p.W340X) mutations were identified in two patients. PMID: 16088246
  34. This study expands the spectrum of CYP4V2 mutations causing BCD and confirms CYP4V2's role in BCD pathogenesis. PMID: 16179904
  35. Novel mutations in CYP4V2 were identified as a cause of BCD. A high carrier frequency for the 15-bp deletion in exon 7 may exist in the Singapore population. PMID: 16186368
  36. A homozygous mutation was identified in two patients, and a heterozygous change in a third, suggesting c.802-8del17bp/insGC is a frequent CYP4V2 mutation. PMID: 17013694
  37. CYP4V2 gene mutations may play a role in BCD. PMID: 17249554
  38. BCD patients with homozygous IVS6-8del17bp/insGC or compound heterozygous IVS6-8del17bp/insGC and IVS8-2A>G mutations showed a more severe phenotype based on electrophysiological testing. PMID: 17962476
  39. SNPs around the CYP4V2 SNP (rs13146272) were associated with deep vein thrombosis and factor XI levels. PMID: 18349091
  40. Observational study of gene-disease association. (HuGE Navigator) PMID: 19583818
  41. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19278955
  42. Observational study of gene-disease association. (HuGE Navigator) PMID: 18349091
Database Links

HGNC: 23198

OMIM: 210370

KEGG: hsa:285440

STRING: 9606.ENSP00000368079

UniGene: Hs.587231

Involvement In Disease
Bietti crystalline corneoretinal dystrophy (BCD)
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Broadly expressed. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, retina, retinal pigment epithelium (RPE) and lymphocytes.

Q&A

What is CYP4V2 and what are its primary functions?

CYP4V2 is a cytochrome P450 enzyme that functions as a fatty acid omega hydroxylase with crucial roles in lipid metabolism pathways. Research has demonstrated its involvement in metabolic syndrome and non-alcoholic fatty liver disease progression through analysis of human tissue samples and mouse models . CYP4V2 appears to regulate cholesterol metabolism, which may influence cell degradative and recycling pathways . Additionally, CYP4V2 mutant cells show elevated triglycerides, free cholesterol, decreased metabolism of pro-inflammatory polyunsaturated fatty acids (PUFAs), and lack certain fatty acid-binding proteins (FABPs) . This suggests CYP4V2 serves a regulatory role in both immune system function and inflammatory responses.

What enzymatic activities have been confirmed for CYP4V2?

CYP4V2 demonstrates activity toward multiple substrates, with particularly well-characterized activity in lauric acid oxidation. Functional studies with wild-type CYP4V2 and variant proteins have established lauric acid as a key substrate for measuring enzyme function . Beyond this, proluciferin substrate assays have identified eight compounds metabolized by CYP4V2, with luciferin-BE and luciferin-3FEME being the most efficient substrates . Interestingly, luciferin-4F2/3 and luciferin-Multi Cyp, which can be converted by other human CYP4 enzymes, are not CYP4V2 substrates . These substrate specificity patterns provide valuable insights into the unique structural features of CYP4V2's active site.

What are the known genetic variants of CYP4V2 and their functional implications?

Research has identified 26 CYP4V2 genetic variants, including 7 novel variants in healthy subjects . Six protein-coding variants have been extensively studied: three novel variants (L22V, R287T, and G410C) and three previously reported variants (R36S, Q259K, and H331P) . Functional characterization revealed that CYP4V2 H331P and G410C exhibit significantly decreased activity for lauric acid oxidation (20-30% of wild-type activity), which correlates with low expression of these substituted proteins . The other four variants showed activity comparable to wild-type CYP4V2. In silico analysis predicted that H331P and G410C substitutions cause structural changes that likely explain their reduced function . Additionally, a novel compound heterozygous variant (c.C958T/p.R320X and c.G1355A/p.R452H) has been identified in a Chinese family with autosomal recessive retinitis pigmentosa .

What expression systems are effective for producing recombinant CYP4V2?

Multiple expression systems have proven effective for producing functional recombinant CYP4V2. For eukaryotic expression, 293T cells can be successfully transfected with expression vectors such as pcDNA/PDEST40 containing CYP4V2 cDNA sequences . This approach has been validated for both wild-type CYP4V2 and amino acid variants, making it suitable for functional characterization studies. Alternatively, recombinant fission yeast strains, such as RAJ232, have been developed to coexpress human CYP4V2 and cytochrome P450 reductase (CPR) . This system enables the creation of permeabilized cells (enzyme bags) that retain enzymatic activity and can be used directly in substrate metabolism assays . The choice between these systems depends on the specific research application, with mammalian cells often preferred for structural studies and yeast systems for high-throughput enzymatic assays.

How can CYP4V2 enzyme activity be measured and quantified?

Several methodologies have been established for measuring CYP4V2 activity. The most widely used approach involves assessing lauric acid oxidation, which has been effectively employed to characterize wild-type and variant CYP4V2 proteins . For high-throughput applications, luminogenic assays using proluciferin substrates provide sensitive and convenient readouts. Eight proluciferin compounds have been identified as CYP4V2 substrates, with luciferin-BE and luciferin-3FEME being the most efficient . These luminogenic substrates can be used with either purified enzyme preparations or permeabilized cells expressing recombinant CYP4V2 and CPR . Additionally, competitive enzyme immunoassay techniques utilizing anti-CYP4V2 antibodies and CYP4V2-HRP conjugates can detect native CYP4V2 in biological samples . The choice of assay depends on the specific research question, with lauric acid oxidation being the gold standard for functional characterization and proluciferin substrates preferred for inhibitor screening.

What approaches are effective for identifying and validating CYP4V2 inhibitors?

A robust testing system for identifying CYP4V2 inhibitors employs luciferin-3FEME as a probe substrate in conjunction with recombinant CYP4V2 expression systems . This approach has successfully identified several inhibitors, with HET0016 showing the strongest effect (IC50 = 179 nM) . Osilodrostat has also demonstrated statistically significant inhibitory potency . For computational approaches, homology modeling of CYP4V2 combined with docking experiments can predict binding interactions and guide inhibitor design . Importantly, inhibitor selectivity should be evaluated, as compounds that inhibit related enzymes (such as CYP4Z1) may not necessarily inhibit CYP4V2, highlighting structural differences between these cytochrome P450 enzymes . Counter-screening against related CYP enzymes is therefore essential for developing truly selective CYP4V2 inhibitors.

How are CYP4V2 mutations linked to retinal diseases?

CYP4V2 mutations have been primarily associated with Bietti crystalline dystrophy (BCD), an autosomal recessive chorioretinal degenerative disease characterized by crystalline retinal deposits, progressive retinal pigment epithelium atrophy, and choroidal sclerosis . Recent research has expanded this disease spectrum, with evidence that certain CYP4V2 variants can also cause retinitis pigmentosa (RP) . Whole-exome sequencing identified a novel compound heterozygous variant (c.C958T/p.R320X and c.G1355A/p.R452H) in the CYP4V2 gene in a non-consanguineous Chinese family with autosomal recessive RP . This variant was absent in unaffected family members and 400 ethnically-matched healthy control individuals, strongly suggesting it as disease-causing . The mechanism linking CYP4V2 dysfunction to retinal degeneration likely involves disrupted lipid metabolism, as CYP4V2 mutant cells exhibit elevated triglycerides and free cholesterol .

What is the emerging role of CYP4V2 in metabolic disorders?

CYP4V2 has been implicated in metabolic syndrome and non-alcoholic fatty liver disease progression through analysis of human metabolic associated fatty liver disease (MAFLD) tissue samples and mouse models representing the MAFLD spectrum (normal liver, steatosis, non-alcoholic steatohepatitis, cirrhosis, and hepatocellular carcinoma) . Mechanistically, CYP4V2 appears to influence cholesterol metabolism, which may regulate cell degradative and recycling pathways . This connection is supported by evidence that cholesterol reduction via cyclodextrins and delta-tocopherol treatment ameliorates Bietti crystalline dystrophy phenotypes . Additionally, CYP4V2 mutant cells lack two fatty acid-binding proteins responsible for trafficking fatty acids throughout cellular organelles and the nucleus, further expanding CYP4V2's potential role in fatty acid metabolic pathways . The enzyme's involvement in metabolism of pro-inflammatory polyunsaturated fatty acids also suggests it may regulate inflammatory responses central to metabolic disease pathogenesis .

How can genetic variants of CYP4V2 be classified for clinical significance?

Classification of CYP4V2 genetic variants requires integration of multiple lines of evidence. Whole-exome sequencing (WES) provides a comprehensive approach for initial variant identification, as demonstrated in studies of families with autosomal recessive retinitis pigmentosa . After WES analysis, variants should be filtered through population databases (dbSNP138, 1000 Genomes Project, Exome Aggregation Consortium) to eliminate common variants unlikely to be pathogenic . Functional variants including frameshift indels, non-synonymous variants, and splicing junction variants should be prioritized . Validation through Sanger sequencing and co-segregation analysis in affected families is essential . Bioinformatics tools such as Mutation Taster, CADD, PROVEAN, PolyPhen-2, Panther, and SIFT can predict the potential pathogenic effects of amino acid substitutions . Finally, functional characterization through enzyme activity assays (e.g., measuring lauric acid oxidation) provides direct evidence of variant impact on protein function .

How can structure-function relationships of CYP4V2 be investigated?

Structure-function relationships of CYP4V2 can be investigated through complementary computational and experimental approaches. Homology modeling based on related cytochrome P450 structures provides insights into the three-dimensional organization of CYP4V2 . These models can be used for docking studies with substrates and inhibitors to predict key binding interactions . Experimentally, site-directed mutagenesis of specific residues followed by functional assays with substrates like lauric acid or luciferin derivatives can validate computational predictions . Comparison of wild-type and variant proteins (such as H331P and G410C) that show reduced activity offers valuable insights into critical structural regions . The correlation between reduced protein expression and decreased enzymatic activity for certain variants suggests that structural integrity affects both protein stability and function . Integration of structural modeling with experimental data provides the most comprehensive understanding of CYP4V2 structure-function relationships.

What are the most promising therapeutic strategies targeting CYP4V2?

Based on current understanding of CYP4V2 biology, several therapeutic strategies show promise. For conditions involving enhanced CYP4V2 activity, selective inhibitors like HET0016 (IC50 = 179 nM) could modulate enzyme function . Conversely, for diseases caused by loss-of-function mutations, gene therapy approaches similar to those developed for other retinal diseases might restore functional CYP4V2 expression. Alternatively, targeting downstream metabolic pathways affected by CYP4V2 dysfunction shows potential, as demonstrated by the amelioration of Bietti crystalline dystrophy phenotypes through cholesterol reduction via cyclodextrins and delta-tocopherol treatment . For metabolic disorders linked to CYP4V2, modulating fatty acid metabolism or inflammatory pathways influenced by CYP4V2 could provide therapeutic benefit . The choice of strategy depends on whether the pathology results from gain or loss of function and the specific tissue affected.

What challenges exist in developing specific and sensitive assays for CYP4V2 in complex biological samples?

Developing specific and sensitive assays for CYP4V2 in complex biological samples presents several challenges. The ELISA kit approach utilizes a competitive enzyme immunoassay technique with anti-CYP4V2 antibodies and CYP4V2-HRP conjugates, where the intensity of color is inversely proportional to the CYP4V2 concentration . This method is suitable for undiluted body fluids and tissue homogenates but may face cross-reactivity issues with related cytochrome P450 enzymes . Activity-based assays using specific substrates like luciferin-3FEME provide functional readouts but require careful optimization for complex samples . The potential presence of multiple CYP4V2 variants with different activities in human populations complicates interpretation . Additionally, low expression levels in certain tissues may necessitate highly sensitive detection methods. Future assay development should focus on increased specificity through antibodies targeting unique CYP4V2 epitopes or highly selective substrates that distinguish CYP4V2 from related enzymes.

How should researchers interpret substrate specificity data for CYP4V2?

Interpretation of CYP4V2 substrate specificity data requires careful consideration of several factors. The observation that eight of ten tested proluciferin compounds are metabolized by CYP4V2, with luciferin-BE and luciferin-3FEME being the most efficient substrates, provides valuable insights into the enzyme's active site preferences . Interestingly, luciferin-4F2/3 and luciferin-Multi Cyp, which are substrates for other human CYP4 enzymes, are not metabolized by CYP4V2 . This distinct substrate specificity profile suggests structural differences between CYP4V2 and related enzymes. When comparing substrate preferences across studies, researchers should consider differences in expression systems, assay conditions, and the presence of necessary cofactors like cytochrome P450 reductase. The lauric acid oxidation assay remains valuable for functional characterization of variants , while proluciferin substrates may be more suitable for high-throughput applications like inhibitor screening .

How can researchers integrate metabolomic and genomic data to understand CYP4V2 function?

Integration of metabolomic and genomic data provides powerful insights into CYP4V2 function. Studies of CYP4V2 mutant cells have revealed elevated triglycerides and free cholesterol, suggesting specific metabolic pathways affected by enzyme dysfunction . These findings can be correlated with genetic data from patients with conditions like Bietti crystalline dystrophy or retinitis pigmentosa to establish genotype-phenotype relationships . The observation that CYP4V2 mutant cells lack two fatty acid-binding proteins highlights potential downstream effects that can be further explored through targeted metabolomics . When metabolomic abnormalities are identified, genetic rescue experiments introducing wild-type or variant CYP4V2 can confirm causal relationships. Additionally, comparing metabolic profiles across different tissues in models with CYP4V2 mutations can reveal tissue-specific functions. This integrated approach has successfully linked CYP4V2 to both retinal diseases and metabolic disorders like non-alcoholic fatty liver disease , demonstrating the value of combining genomic and metabolomic methodologies.

What are the key unanswered questions about CYP4V2 biology?

Despite significant progress, several key questions about CYP4V2 biology remain unanswered. The complete spectrum of physiological substrates for CYP4V2 across different tissues has not been fully characterized, though some progress has been made with proluciferin compounds and lauric acid . The three-dimensional structure of CYP4V2 has been approached through homology modeling , but experimental structure determination would provide crucial insights for drug design. The precise mechanisms linking CYP4V2 dysfunction to retinal degeneration in Bietti crystalline dystrophy and retinitis pigmentosa require further elucidation . Similarly, while CYP4V2 has been implicated in metabolic-associated fatty liver disease progression , the specific metabolic pathways regulated by CYP4V2 in hepatocytes need clarification. The regulation of CYP4V2 expression in different tissues and conditions remains largely unexplored. Addressing these questions will significantly advance understanding of CYP4V2 biology and its therapeutic targeting.

How might advances in gene editing and delivery systems impact CYP4V2-focused therapeutics?

Advances in gene editing and delivery systems offer promising approaches for CYP4V2-focused therapeutics, particularly for conditions caused by loss-of-function mutations. For retinal diseases like Bietti crystalline dystrophy and retinitis pigmentosa associated with CYP4V2 mutations , adeno-associated virus (AAV) vectors could potentially deliver functional CYP4V2 to retinal pigment epithelium cells. CRISPR-Cas9 technology might enable correction of specific mutations, such as the compound heterozygous variant identified in retinitis pigmentosa patients . For metabolic disorders linked to CYP4V2 dysfunction , lipid nanoparticles could deliver mRNA encoding functional CYP4V2 to hepatocytes. The development of tissue-specific promoters would allow targeted expression in relevant cell types. Additionally, the identification of compounds that can modulate CYP4V2 activity or stabilize mutant proteins, similar to pharmacological chaperones developed for other enzymes, represents a complementary therapeutic strategy that could benefit from structural insights gained through CYP4V2 modeling .

What interdisciplinary approaches might accelerate understanding of CYP4V2 in health and disease?

Accelerating understanding of CYP4V2 requires interdisciplinary approaches combining expertise from multiple fields. Integration of structural biology techniques (X-ray crystallography, cryo-electron microscopy) with computational modeling would provide crucial insights into CYP4V2's three-dimensional structure and substrate interactions . High-throughput metabolomics coupled with genetic manipulation in cellular and animal models could identify physiological substrates and metabolic pathways regulated by CYP4V2 . Clinical collaborations focusing on detailed phenotyping of patients with CYP4V2 mutations would clarify genotype-phenotype relationships and disease mechanisms . Pharmaceutical chemistry approaches could develop selective CYP4V2 inhibitors as both research tools and potential therapeutics . Systems biology integrating transcriptomic, proteomic, and metabolomic data could reveal broader regulatory networks involving CYP4V2. Finally, translational research bridging basic science findings with clinical applications would accelerate the development of diagnostic tools and therapeutic strategies for CYP4V2-associated diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.